KEGG   Lactobacillus brevis ATCC 367: LVIS_0253Help
Entry
LVIS_0253         CDS       T00406                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lbr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(268045..269280)
Genome map
AA seq 411 aa AA seqDB search
MDEVVQALSDVIKLNTVNGNEKVVADYLADLLAKHGIDSKAVAYEPDRVSLVAEIGDGHG
PVVGFDGHEDIVALGDAAKWDADALSAKIADGKMFGRGTTDMKSGLMAGVFAMIHLKENN
VPLHGTLRLMATVGEEYGQFGARQLAEAGYAKNLDTLIVGEPSGVVKQAVATPQIQQMLQ
INQDSANKLMAANQTTEQHFIELAHKGSLTYTVSAQGVAAHSSMPEIGKNAIDSLLTFYQ
KQQAYFATITDKKNPVLGATVPVVTLIQGGEQINTVPASASISVKIRTIPEVPNTKLAAD
IQQLIDELNANGEQLSLDIHSNLYPVHTADDAPVVKAAKECGEADLQQALPLIGVPGGTD
ASSFVAVNPDIDVVVFGPGNITAHQVNEYVDLDMYHRFITIYEKMITRLLA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaagttgtgcaagcactcagtgacgtcatcaaactcaacacagttaatggtaat
gaaaaggtcgttgccgactatctggctgatctattagccaaacatggtatcgatagtaag
gctgtcgcctatgaacctgatcgggtcagtcttgtagccgagattggcgatggtcatggt
cccgttgtgggatttgacggccatgaagatatcgttgccttgggggatgccgccaagtgg
gatgcagatgccttgtctgccaaaatcgctgacggcaagatgtttggtcgtggcaccaca
gatatgaagtccggcttaatggctggcgtctttgcgatgattcacttaaaagaaaataat
gttcccctacacggcacattacgcttaatggcaaccgttggtgaagaatatggtcaattc
ggcgcccggcagttagctgaggccggttatgctaagaacctagacaccctcattgttggt
gaacccagcggtgtcgttaaacaagccgtggccaccccacaaatccaacagatgttgcaa
attaaccaggacagcgccaataagttaatggccgccaatcaaacgactgaacaacacttc
attgagttagcgcacaagggctctttgacgtatacggtgagtgctcaaggcgtggcggca
catagttcaatgccagaaattggtaaaaatgccattgattcactgctaaccttctaccaa
aaacaacaggcctacttcgcgactatcaccgataagaagaatccggtcttaggggccacg
gttcccgttgtcactctgattcagggtggcgagcagattaacacggttccagccagtgcc
tcgatttcggttaaaatcagaaccattccggaagtgccgaacaccaagttagccgctgat
atccagcagctcatcgacgagctaaatgctaacggggaacaactttccttagatattcac
agtaacctgtatcccgtgcacactgccgatgatgcaccagtggttaaagcagctaaagaa
tgcggtgaggctgacttacaacaagccttaccacttatcggcgttcccggtggaactgac
gcatcgtccttcgttgcagttaatccagatatcgacgttgtggtctttggcccgggaaac
atcacagctcaccaagtgaacgaatacgttgacctagacatgtatcaccgtttcatcacc
atctatgaaaagatgattacacgtttgttggcttaa

DBGET integrated database retrieval system