KEGG   Lactobacillus brevis ATCC 367: LVIS_0254Help
Entry
LVIS_0254         CDS       T00406                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LVIS_0254 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0254 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LVIS_0254 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LVIS_0254 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LVIS_0254 (adhA)
   00626 Naphthalene degradation
    LVIS_0254 (adhA)
Enzymes [BR:lbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LVIS_0254 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
269650..270660
Genome map
AA seq 336 aa AA seqDB search
MKAAVVRDSLDGYVDIKEVPVRKIKANEALVDVEYCGLCHTDLHVAQGDFGNTAGRVIGH
EGVGRVKEIGSDVTSLKVGDRVSIAWFFAGCGHCEYCLTGRETLCRNVENAGFNVDGAMA
EQVIVKADYAVKVPDDLDPVQASSITCAGVTTYKALKVANLHPGEWVTIYGCGGLGNLAI
QWAKNVFKAHVIAIDINDDKLASAKKVGADLTFNSKTEDSGAWVQDKIGGAHAAVVTAVS
QIAFDQAIGSVRAGARVVAVGLPKGAMEVSIVKVVLDGIEIAGSLVGTRQDLAEAFQLCA
EGDVTPIVATRKLEEVNDIIDEMKAGKIEGRMVVKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagttgttcgtgatagtttagatgggtatgtagatattaaagaggtacca
gtacggaaaatcaaggccaatgaagccttagttgatgtggaatattgtggcctgtgtcac
actgatttacacgtcgctcaaggtgattttggcaacactgctggtcgggttatcggccac
gaaggggttggtcgggttaaagagatcggaagtgacgtcaccagtttgaaggtgggggat
cgcgtatcaatcgcgtggttctttgccgggtgtggtcactgtgaatactgtttaactggt
cgtgaaacgctatgccggaacgttgaaaatgccggatttaacgtagatggagcaatggct
gaacaggttatcgtgaaagctgattatgcggtcaaggtgccggatgatcttgaccccgtt
caagccagctcgatcacgtgtgccggtgtcaccacatataaagcattaaaagttgccaac
ttacatcctggcgaatgggtcaccatttatggttgtggtggtctcggaaatctagccatt
caatgggcgaagaatgtctttaaggcccacgttattgcgatcgatatcaatgatgataaa
ctagccagtgctaaaaaggtcggcgctgatttaaccttcaattctaagacagaagattct
ggcgcttgggtgcaagataaaatcggtggtgcccacgccgcagttgtcacggccgtatca
caaattgccttcgatcaggccattggctctgtgcgggctggtgctcgcgtcgttgctgtc
gggttaccaaagggtgccatggaagtctccatcgtgaaggtcgtcttagacggcattgaa
attgcgggttctttagtgggcacgcgacaagacttagctgaagccttccagttatgcgca
gaaggggatgtcaccccaatcgtagctactcggaagcttgaggaagttaacgatattatt
gatgaaatgaaagcggggaagattgaaggccggatggtcgtcaagttctaa

DBGET integrated database retrieval system