KEGG   Lactobacillus brevis ATCC 367: LVIS_0254Help
Entry
LVIS_0254         CDS       T00406                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00010  Glycolysis / Gluconeogenesis
lbr00071  Fatty acid degradation
lbr00350  Tyrosine metabolism
lbr00625  Chloroalkane and chloroalkene degradation
lbr00626  Naphthalene degradation
lbr01100  Metabolic pathways
lbr01110  Biosynthesis of secondary metabolites
lbr01120  Microbial metabolism in diverse environments
lbr01130  Biosynthesis of antibiotics
lbr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0254
  Lipid metabolism
   00071 Fatty acid degradation
    LVIS_0254
  Amino acid metabolism
   00350 Tyrosine metabolism
    LVIS_0254
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LVIS_0254
   00626 Naphthalene degradation
    LVIS_0254
Enzymes [BR:lbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LVIS_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABJ63420
JGI: LVIS0254
UniProt: Q03TQ2
Position
269650..270660
Genome map
AA seq 336 aa AA seqDB search
MKAAVVRDSLDGYVDIKEVPVRKIKANEALVDVEYCGLCHTDLHVAQGDFGNTAGRVIGH
EGVGRVKEIGSDVTSLKVGDRVSIAWFFAGCGHCEYCLTGRETLCRNVENAGFNVDGAMA
EQVIVKADYAVKVPDDLDPVQASSITCAGVTTYKALKVANLHPGEWVTIYGCGGLGNLAI
QWAKNVFKAHVIAIDINDDKLASAKKVGADLTFNSKTEDSGAWVQDKIGGAHAAVVTAVS
QIAFDQAIGSVRAGARVVAVGLPKGAMEVSIVKVVLDGIEIAGSLVGTRQDLAEAFQLCA
EGDVTPIVATRKLEEVNDIIDEMKAGKIEGRMVVKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagttgttcgtgatagtttagatgggtatgtagatattaaagaggtacca
gtacggaaaatcaaggccaatgaagccttagttgatgtggaatattgtggcctgtgtcac
actgatttacacgtcgctcaaggtgattttggcaacactgctggtcgggttatcggccac
gaaggggttggtcgggttaaagagatcggaagtgacgtcaccagtttgaaggtgggggat
cgcgtatcaatcgcgtggttctttgccgggtgtggtcactgtgaatactgtttaactggt
cgtgaaacgctatgccggaacgttgaaaatgccggatttaacgtagatggagcaatggct
gaacaggttatcgtgaaagctgattatgcggtcaaggtgccggatgatcttgaccccgtt
caagccagctcgatcacgtgtgccggtgtcaccacatataaagcattaaaagttgccaac
ttacatcctggcgaatgggtcaccatttatggttgtggtggtctcggaaatctagccatt
caatgggcgaagaatgtctttaaggcccacgttattgcgatcgatatcaatgatgataaa
ctagccagtgctaaaaaggtcggcgctgatttaaccttcaattctaagacagaagattct
ggcgcttgggtgcaagataaaatcggtggtgcccacgccgcagttgtcacggccgtatca
caaattgccttcgatcaggccattggctctgtgcgggctggtgctcgcgtcgttgctgtc
gggttaccaaagggtgccatggaagtctccatcgtgaaggtcgtcttagacggcattgaa
attgcgggttctttagtgggcacgcgacaagacttagctgaagccttccagttatgcgca
gaaggggatgtcaccccaatcgtagctactcggaagcttgaggaagttaacgatattatt
gatgaaatgaaagcggggaagattgaaggccggatggtcgtcaagttctaa

DBGET integrated database retrieval system