KEGG   Lactobacillus brevis ATCC 367: LVIS_0465Help
Entry
LVIS_0465         CDS       T00406                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0465
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LVIS_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
494098..495573
Genome map
AA seq 491 aa AA seqDB search
MTKKTLPADFLWGGAVAAHQVEGAYDVGGKGLSVADVMTAAGTHDERRITAGVQPNEFYP
NHEAVDFYHQYPADVKLFAEMGFKCFRTSIAWSRIFPQGDEVEPNEAGLAFYDRLFDECH
KYHIEPVVTLSHFEMPYHLVTKYGGFRSRQTIKFFTRFAQTVFERYRDKVTYWLTFNEIN
NQINYDRAFTLFTNSGIQVQPGENAEAVMYQASHYEVVASAIAVQIAHTINPDFQVGAMV
AFSPVYPATDKPRDVFKAQRAMQARFWYSDVQVEGQYPTWLTNYFETKGFDLDITAADLA
NLRQGTVDYLGFSYYMSFATAATDDEDDQFSYNETDDLVTNQFVPQSAWGWQVDPQGLRY
GLNWMNDRYHLPLFIVENGIGAIDQLTATHEVHDQYRIDYLHDHIDQMELAMTEDGVPVM
GYTPWSAIDIVSASTGQLSKRYGVIYVDRNDDGSGSLARYRKDSFYWYQRVIASNGADLT
PTGGEHDGSKA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaaaaaacattaccagcagattttttatggggaggtgctgtagcagcacaccaa
gttgaaggcgcttacgacgttggcggtaaggggttaagcgtggccgatgttatgacggcc
gccgggacgcacgatgaacggcgaattaccgccggtgttcaacccaatgagttctatcct
aaccatgaagctgtggatttttatcatcagtatcccgcggatgtcaaactctttgctgaa
atgggcttcaagtgttttcgaacgtcgattgcgtggtcccgaatttttccacaaggtgat
gaggtcgagcccaatgaagctggacttgccttctatgatcgcctgtttgatgagtgtcat
aaatatcatattgaaccggtcgtgacgttgtctcattttgagatgccctatcacttagtg
accaaatacggtggcttccgaagtcggcaaacgattaaattctttacccgctttgctcaa
acggtctttgaacgttaccgcgacaaggtgacctactggttgacctttaacgaaattaat
aatcaaattaactacgatcgggccttcacgctctttaccaattcaggtattcaagtacag
ccgggagaaaatgccgaagcagtgatgtatcaagccagccattacgaggttgttgccagt
gcgattgcggttcaaatcgcccacacaattaatcctgattttcaggttggggcgatggtc
gcattttcaccagtttatcccgccacggataagccccgtgatgtcttcaaggcacaacgg
gctatgcaggcgcgcttctggtattccgatgttcaagttgaaggtcagtatccgacttgg
ttgaccaactactttgaaaccaaggggtttgatctggacatcaccgcagctgacttagct
aatttgcggcaaggtacggtcgattacttgggctttagctactacatgtcttttgccacc
gcggcgactgacgatgaggatgaccaattctcttataacgaaactgatgatttagtgacc
aaccaatttgttccgcaatccgcttggggctggcaagttgatccacaaggactgcggtat
ggcttgaactggatgaacgatcgctaccacttgcctttgttcattgtggaaaatggcatt
ggcgcgattgaccagttgacggcaactcatgaggtccatgaccaataccggattgactat
ctgcatgaccatattgatcaaatggagttggcgatgaccgaagatggcgtgccagtaatg
ggatataccccgtggagtgccattgacattgtttctgccagcacgggtcaattatccaaa
cggtatggggtcatctatgtcgatcggaacgatgatggcagtgggagcctcgctcgctac
cgtaaggactcattttattggtatcaacgggtaattgcctcgaatggggctgacttaacg
ccgactggtggtgaacatgatggcagtaaagcgtga

DBGET integrated database retrieval system