KEGG   Lactobacillus brevis ATCC 367: LVIS_0602Help
Entry
LVIS_0602         CDS       T00406                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LVIS_0602 (recR)
DNA repair and recombination proteins [BR:lbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LVIS_0602 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
632720..633319
Genome map
AA seq 199 aa AA seqDB search
MQYPEPIAQLIDGYMKLPGIGQKSATRLAFFTIDMAEDDVTAFSKALIAAKRDLHFCSIC
GNITEGDPCSICADKTRDQTHVLVVEQPKDIMVMEKMKEYHGLYHVLHGVMSPIEGKGPE
DLNIASLINRLQQNPNIKEVIIATNATPEGEATAMYLSRLIKPAGIKVTRLAHGLSVGSD
IEYADEMTLFKAVEGRTEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccagaacccattgcccagttgattgatgggtacatgaaattgccaggaatt
ggacagaagtcggcgacacgcttggctttctttacgattgatatggctgaagacgatgtg
acggctttttctaaggcgttgattgccgccaaacgggatcttcatttttgctcaatctgt
ggcaacatcacggagggtgatccgtgttcaatttgtgcagataagacgcgcgaccaaacc
catgtactggtggttgaacaacctaaagacatcatggttatggaaaagatgaaagaatat
catggcttataccatgtgttacatggggtcatgtcgccgattgaaggcaagggccctgag
gatttgaatattgcgagcctgattaatcgactccaacaaaaccctaatattaaagaagtc
attattgcgacgaacgcgacaccagaaggggaagcaacggcaatgtacttgtcccggttg
attaagccggcgggtatcaaagtgacgcgcttagcccatggcttgtcagtcggcagcgat
attgaatacgccgatgaaatgaccttatttaaggccgttgaagggcggacagagatgtag

DBGET integrated database retrieval system