KEGG   Lactobacillus brevis ATCC 367: LVIS_0644Help
Entry
LVIS_0644         CDS       T00406                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LVIS_0644
   00052 Galactose metabolism
    LVIS_0644
   00500 Starch and sucrose metabolism
    LVIS_0644
   00520 Amino sugar and nucleotide sugar metabolism
    LVIS_0644
Enzymes [BR:lbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LVIS_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
672005..672910
Genome map
AA seq 301 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVIVDGKS
KRSIEDHFDSNPELEANLEAKHKDEMLRQVKETTGMNLYFIRQPYPRGLGDAVLTAKAFI
GDEPFIVMLGDDMTDSKVPLTKQLIDRYDQTGASTLAVMRVPHKDTAKYGVINPSEETAP
GLYNVTNFVEKPEPDEAPSDLAIIGRYLFTPEIFEALESTPVGLGNELQLTDAIDNLNKT
QRVFAHEYTGKRFDVGNKFGWIQTNIAYGLQHPETKTQLREYIKTLGAQLAKEDEQTPKS
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgtcattccagcagctggattaggaacccgttttttacca
gccacgaaggctttagctaaagaaatgttaccgattgttgataagccaactatccaattt
atcgtggaggaagcgcgcaaatcgggaattgaagatattgtgattgtcgatgggaaatct
aagcgatccatcgaagaccattttgactccaatccagaattggaagctaatctagaagct
aagcacaaagatgaaatgctacgacaagttaaggaaacgactggcatgaatctatacttt
atccgacaaccgtacccacgtgggttgggggatgcagtattgacggcgaaggcctttatt
ggtgatgaaccatttatcgtgatgttaggcgatgatatgacagatagcaaggtgccctta
accaagcaattgattgatcgctatgatcaaacgggggcttcaaccttggctgtgatgcga
gttccacataaggatacggcgaagtatggagtcattaatccgtctgaagaaacggcgcca
ggtttgtataacgttaccaactttgtggaaaagccagaaccagatgaagcacctagtgat
ctagccattattggtcgttacctctttacgccagaaatctttgaagcgttggaaagcacc
ccagtgggcttaggcaatgaattacaactgacagacgccattgataacctcaataaaaca
caacgcgtgtttgcccacgaatatacaggcaaacggtttgatgtcggcaataagttcggc
tggattcagaccaatattgcgtatggtcttcaacatccagaaacaaaaacacagttacgc
gagtacattaagaccttaggcgctcagcttgccaaggaagatgaacaaacacccaagtca
aaatag

DBGET integrated database retrieval system