KEGG   Lactobacillus brevis ATCC 367: LVIS_0663Help
Entry
LVIS_0663         CDS       T00406                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00010  Glycolysis / Gluconeogenesis
lbr00051  Fructose and mannose metabolism
lbr00562  Inositol phosphate metabolism
lbr01100  Metabolic pathways
lbr01110  Biosynthesis of secondary metabolites
lbr01120  Microbial metabolism in diverse environments
lbr01130  Biosynthesis of antibiotics
lbr01200  Carbon metabolism
lbr01230  Biosynthesis of amino acids
Module
lbr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0663
   00051 Fructose and mannose metabolism
    LVIS_0663
   00562 Inositol phosphate metabolism
    LVIS_0663
Enzymes [BR:lbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LVIS_0663
Exosome [BR:lbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LVIS_0663
  Exosomal proteins of bladder cancer cells
   LVIS_0663
  Exosomal proteins of melanoma cells
   LVIS_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABJ63806
JGI: LVIS0663
UniProt: Q03SL6
Position
690911..691669
Genome map
AA seq 252 aa AA seqDB search
MRIPLIAGNWKMNKSVTEARQFIDAVQGQLPQADVIETAVAAPALFLQTMLDANAEGTLR
VAAETCYYEDEGAYTGETSPRALHEMGIPYTIVGHSERRRYFNETDDVINRKVQAVFRNG
MTPILCCDETMGRRTAGEKIHWVVNQVSAALKGVSAEDAAKIVVAYEPSWAIGSGTSASS
DQAEEGCYLIRQTLADIYSDDLANGVRVLYGGSVKPDNIAGLMAKSNVDGVLAGGSSLDE
TSFIQLANYQNL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaataccactcattgctggtaattggaaaatgaataagtcggtcactgaggcacgt
caattcatcgatgccgtacagggtcaattaccgcaggcagatgttattgaaacggccgtg
gcggcgccagcgttgtttttacaaacgatgctggatgccaatgctgaagggacactgcga
gttgctgcagaaacctgttactacgaagatgaaggggcttatacgggagaaaccagccca
cgggcacttcatgaaatggggattccctacacgatcgtgggtcattcggaacgtcgccgg
tactttaatgagaccgatgatgtgattaatcgtaaggtgcaagcggtctttcgtaacggc
atgacacctattctgtgttgtgatgaaacgatgggtcggcgaactgctggtgaaaagatc
cattgggtcgttaatcaagtttcagcagccttaaaaggggttagtgccgaagatgccgct
aagatcgtcgttgcttacgaacctagctgggcgattggtagtggcacctcagcatcatct
gatcaggccgaagagggttgttatttgattcggcagacactagctgacatctactcggat
gatttggccaacggtgtgcgggtattgtatggtggtagtgtgaagccagataatattgcc
ggtttgatggctaaatcaaatgtggatggtgtgttagcgggtggttccagtttggatgaa
acctcatttattcagctggctaactaccaaaatttgtaa

DBGET integrated database retrieval system