KEGG   Lactobacillus brevis ATCC 367: LVIS_0663Help
Entry
LVIS_0663         CDS       T00406                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LVIS_0663 (tpiA)
   01230 Biosynthesis of amino acids
    LVIS_0663 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0663 (tpiA)
   00051 Fructose and mannose metabolism
    LVIS_0663 (tpiA)
   00562 Inositol phosphate metabolism
    LVIS_0663 (tpiA)
Enzymes [BR:lbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LVIS_0663 (tpiA)
Exosome [BR:lbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LVIS_0663 (tpiA)
  Exosomal proteins of bladder cancer cells
   LVIS_0663 (tpiA)
  Exosomal proteins of melanoma cells
   LVIS_0663 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
690911..691669
Genome map
AA seq 252 aa AA seqDB search
MRIPLIAGNWKMNKSVTEARQFIDAVQGQLPQADVIETAVAAPALFLQTMLDANAEGTLR
VAAETCYYEDEGAYTGETSPRALHEMGIPYTIVGHSERRRYFNETDDVINRKVQAVFRNG
MTPILCCDETMGRRTAGEKIHWVVNQVSAALKGVSAEDAAKIVVAYEPSWAIGSGTSASS
DQAEEGCYLIRQTLADIYSDDLANGVRVLYGGSVKPDNIAGLMAKSNVDGVLAGGSSLDE
TSFIQLANYQNL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaataccactcattgctggtaattggaaaatgaataagtcggtcactgaggcacgt
caattcatcgatgccgtacagggtcaattaccgcaggcagatgttattgaaacggccgtg
gcggcgccagcgttgtttttacaaacgatgctggatgccaatgctgaagggacactgcga
gttgctgcagaaacctgttactacgaagatgaaggggcttatacgggagaaaccagccca
cgggcacttcatgaaatggggattccctacacgatcgtgggtcattcggaacgtcgccgg
tactttaatgagaccgatgatgtgattaatcgtaaggtgcaagcggtctttcgtaacggc
atgacacctattctgtgttgtgatgaaacgatgggtcggcgaactgctggtgaaaagatc
cattgggtcgttaatcaagtttcagcagccttaaaaggggttagtgccgaagatgccgct
aagatcgtcgttgcttacgaacctagctgggcgattggtagtggcacctcagcatcatct
gatcaggccgaagagggttgttatttgattcggcagacactagctgacatctactcggat
gatttggccaacggtgtgcgggtattgtatggtggtagtgtgaagccagataatattgcc
ggtttgatggctaaatcaaatgtggatggtgtgttagcgggtggttccagtttggatgaa
acctcatttattcagctggctaactaccaaaatttgtaa

DBGET integrated database retrieval system