KEGG   Lactobacillus brevis ATCC 367: LVIS_0668Help
Entry
LVIS_0668         CDS       T00406                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lbr  Lactobacillus brevis ATCC 367
Brite
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LVIS_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
696352..697110
Genome map
AA seq 252 aa AA seqDB search
MIRKPTPLFFEQGPQAVILLHAYSGSSNDMRLLARRLQSENYTVLAPIFSGHATGDPADI
LRQGSPQQWWQDTQTAIANLRQRGYQQIAIFGLSLGGLFATRALMADPELQGGGTIASPV
IFRGQTNVPATFMQMAQADYQSQGLSVDEQTKRLAWLKEQLPAQLTAIQAFADTTATHLE
RVKQPVFIAQGDADQMIDPRSGQWLADAYPSEQIDFHEYAGAGHVLTVNAAHHVLETDIL
AFLQTIFKNNEE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaaaaccaaccccgctcttctttgagcagggacctcaagcagtgattctactg
cacgcttactccggtagttccaacgacatgcggttattggctcggcgacttcagagcgag
aattataccgtcttagcgcccatcttttcgggccacgcaaccggtgatcccgcggatatt
ttacggcagggttcaccacagcaatggtggcaagacacgcaaacagcgattgccaatttg
cggcagcgaggttaccaacagattgccatctttgggttgtctttgggcggcctctttgcg
acgcgggctttgatggctgacccagagttgcaaggtggtggcacgattgcgtcgcccgtt
atctttcgggggcagactaacgtgccagcaacatttatgcaaatggcccaggcggattat
cagtcacaagggttgtcagtcgatgaacagactaagcgcttggcctggctgaaggaacag
ctgccagcacaattgacagcaattcaggcatttgcagataccacggcgacccacttggag
cgtgtcaaacaaccggtctttattgcccagggtgacgcggatcagatgattgacccccgt
tctgggcaatggctagcagatgcttatccatctgaacaaattgattttcatgagtatgcc
ggtgccggccacgtgctgacggttaatgcggcacaccatgtattggaaacagacattttg
gcgtttttacaaacaatctttaaaaataacgaggaatag

DBGET integrated database retrieval system