KEGG   Lactobacillus brevis ATCC 367: LVIS_0785Help
Entry
LVIS_0785         CDS       T00406                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LVIS_0785
   00670 One carbon pool by folate
    LVIS_0785
Enzymes [BR:lbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LVIS_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
815779..816270
Genome map
AA seq 163 aa AA seqDB search
MLIFLWAESQGRVIGLHGGLPWHLPADMHYFKTVTTGHTIVAGSKTFASFPRPLPNRKNI
VVSHQPATAFPENVSVLHSLPAVRAYAAARPQEKIFVVGGAQLFAGLLDDVDFLYRTRID
AGFDGDTWMPVIDYSQFTLIDQQPGIRNEKNPYDFVFEQYQRH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgctaatctttttatgggcagagagccagggacgagttatcgggctgcacggcggctta
ccatggcatttaccggctgacatgcattacttcaaaacggtgacgacgggtcatacaatt
gtggccggaagcaaaacctttgcttcatttccacgaccgctacctaaccgtaaaaatatc
gtggtttctcatcaaccagcaacggctttcccagaaaatgtcagcgtgctgcactcattg
ccagcggtgcgggcctacgcagcagctcgcccacaagaaaaaatatttgtggtcggtggg
gcgcaactatttgctggcctgctggatgacgttgatttcctgtatcgaacccggattgac
gccggatttgatggcgatacatggatgccagtgatcgattacagtcaatttacgctaatt
gaccaacaaccagggattcgtaatgaaaaaaatccgtatgattttgtttttgaacaatat
cagcggcattaa

DBGET integrated database retrieval system