KEGG   Lactobacillus brevis ATCC 367: LVIS_0829Help
Entry
LVIS_0829         CDS       T00406                                 

Definition
carbamoylphosphate synthase large subunit
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lbr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lbr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(858162..860738)
Genome map
AA seq 858 aa AA seqDB search
MPSLNDIQKVLIIGGGPTEIGHETELDSATVQIMTEFKKHGVRTLIIDNNPFSVALEEIQ
PTNMYVQAVTTENVRHIIEKDQPDAILPSLGGLLGIQIAQELIEDGDIGRFGVTVLGMAP
ATLRQINNPAALNATLKEIQEPIIEAQVVSTTDEAMGMVEAIGFPLIVKPVSPRVDTNRT
ICENVDDMLTALNQGFQQSRFDQCSLERSVVGYKEVEMVAVRDVADTKILICGLENIDPI
GIHSGDSIVVTPPQTLNDREYQDLRDATFRIATELGIVGVLHLHFALNPANQHFYVTKIA
PYFTRGVALAARTTGYPIALVVGALLLGQRLVDVKLPGGYVKQTAIMEPMVDHVGVRIPL
WPFQEVPDADQHLDTVMKAVGSTIGLGRSVEEALLKSVRSSQFSPRDVLPSVSNLTDGEM
IRQLIHPLANRILVLIEALRRGYSPAELSELTKIDNFYFVKLQHLLLIEQAIKDHPLDVD
VLQRARYFGFGDGMIARIWQTDTAKIRQLLADARIAPTYKMIEPTAGEFPEKTSGFYSTF
EYENESQSLGERTALVLGRGGNQLGPNSAAEYFTTEMLKQLKRAGYHTILMNTNPNAVAI
APEFSDKQYVDPIQLGDVLNVIHVEHPDIVIVPGNRHYLTRELSKLDINLHVLPPDQETD
QPAPEMATIGVSLFVHNQHKLAVGVMDMIAPGMNKALSQVTAFRMPAELPRSRRTNLVEQ
AKQAVSERQVTGMVQVLFAPKPDSDSHQLTVVGVRPSRLTEMAFLSKVTGVNWVRMLTRQ
HIGTLDDAELSAIKVDIHSNRVALMNAAFPFRQLHVLNRPGTTDQEVGATIAFGSSEALT
LTNLSDTDELDRIINRTI
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagtttaaatgacatacaaaaagtgttgattattggcggcggaccaacagagatc
ggccatgaaacggaactagatagcgcgaccgtacaaatcatgacggaatttaaaaaacac
ggtgtacgtaccttaataatcgataataacccattttctgtcgcgcttgaagagattcag
ccgaccaacatgtatgtccaggcggtgacgactgaaaatgttcggcacattattgaaaag
gatcagccggacgccattttaccatctttaggtggtttattaggtatccagatcgcccag
gaactcattgaagatggtgacattggtcgttttggggtaaccgtgttaggcatggcaccg
gcgaccttgcggcagattaacaatccggcggcgttgaacgcaacgcttaaggaaattcag
gagcccattatcgaggcccaagtggtcagtacaactgatgaagctatggggatggttgag
gccattggcttccccctaattgtgaaacccgtgtcgccgcgggtggatacgaaccgcacc
atttgtgaaaatgtcgatgacatgctgacggcgttgaatcaaggattccagcaatcccgg
tttgatcaatgctcattggagcgaagtgtcgtgggctacaaggaagtcgaaatggttgcg
gtgcgggatgtagcggatacaaagattctgatttgtggtttggaaaatattgatcccatt
gggattcactccggggattcaattgtggtgactccgcctcagacgttaaacgatcgcgag
tatcaggatctgcgggatgcgacatttcggattgccaccgagttggggattgttggggtg
ttacatcttcactttgccctaaatccggccaaccagcacttctatgtgacgaagattgcc
ccttactttacacgcggggtggcactggcagcacgaacaacgggatatcccattgcatta
gttgtgggggcattgttgttgggccaacgcctagtagatgttaagctgcccggtggttat
gttaaacagaccgcgatcatggaaccgatggtggaccatgttggggtacgaattccgtta
tggccgtttcaagaggtgcccgatgctgaccagcatttagacactgtgatgaaggcagtc
gggtcgaccattggcttgggccgttcagtcgaagaagcgctattaaaatcagtgcggagt
tcccaattttctccccgtgacgttttacctagtgttagtaatctaacggatggtgagatg
attcggcagctgattcatccattggctaaccggattttagttttgattgaagctctacgc
cgggggtattcacctgccgagctgagtgagttgaccaagattgataatttttactttgta
aagctccagcacctgttgttaattgaacaggcaatcaaggatcatccccttgatgttgat
gtcttacagcgggcccggtacttcgggtttggtgatgggatgattgcgcgtatctggcaa
acggataccgctaagattcggcaattgctggcggatgctcgcattgccccaacgtataag
atgattgaaccgacagctggtgaatttccggaaaagactagtggtttttatagcaccttt
gagtatgaaaatgagagtcagtcactgggagagcggacggccttagtcttaggacggggc
ggtaatcaactaggccctaactcagcggcagagtattttacgactgaaatgttaaagcag
ttaaaacgggcgggttatcacacaattctgatgaatacgaatcccaatgcggtcgcaatt
gcgccagagttctcggacaagcagtatgtggaccctattcaattgggggatgtgcttaac
gtgattcacgttgagcacccggatattgtgattgttcccggtaaccggcattatttaacc
cgtgagttgagtaagttagatatcaatctgcacgtgttacccccagatcaagaaacagac
caacctgcgccggagatggcaacgattggggtgagcctgtttgttcataatcagcataag
ttagcggttggggtgatggatatgattgctcccggaatgaataaggcgttatcccaggtg
acggcatttcgaatgccggcggagttaccccgttcacgacgaacaaacttagttgaacag
gccaaacaagcggttagtgaacgacaggtgaccgggatggttcaggttctctttgcccct
aaaccggattcagatagccaccagctgaccgtggtgggtgtgcgaccgagccggctaact
gaaatggcgtttcttagcaaagtaacgggtgtcaattgggtgcggatgttgacgcgacaa
catattggaacgctagatgatgcggaattatcggcaatcaaagtggacattcacagtaat
cgagttgcgttaatgaatgcggcctttccgttccgccagttacatgttttgaatcggccc
ggaaccacggatcaagaagtgggggcaaccatcgcttttggttcaagtgaggcgttaacg
ttgaccaaccttagtgatacggatgagttagaccgaattattaatcgaactatttag

DBGET integrated database retrieval system