KEGG   Lactobacillus brevis ATCC 367: LVIS_1231Help
Entry
LVIS_1231         CDS       T00406                                 

Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LVIS_1231
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LVIS_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1202095..1202703)
Genome map
AA seq 202 aa AA seqDB search
MYEYLHGLITAVYPDHVVVDVNGVGYLVNTANPYRYEVSATAVTIYVYQAVSDTAQTLYG
FSDFAEKQLFLKLINVNGIGPKSALAILANPDHQGLMMAIKTNDTGFLTKFPGVGKKTAG
QIVLDLQNKLDDLAPATDDNTLFTPEVAPTTTENPQLADALAALTALGYRETAVKKITAQ
LRQFNGQTTNDYLSEGLRLLTK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaataccttcacggcctcattacagcggtctatccggaccatgtagtggtagat
gtcaatggcgtcggttatttagtgaatacggcgaacccctatcgttatgaagtgagtgcc
acagcagttacgatttatgtgtatcaggcagtcagcgatacggcacaaaccttatacggg
tttagtgattttgctgaaaaacaattatttctaaaattaattaatgtcaacggtattggc
cctaaaagtgcgttggccattttggctaacccggatcatcagggactgatgatggcaatt
aaaaccaacgatactggattcttaaccaagttccctggggtgggaaagaagacggctggt
caaatcgtgttagacttgcaaaataagttagatgatttagcgccggctactgatgataat
accctgttcacaccagaagtggccccgacaaccactgaaaatccgcagttagccgatgcc
ttggcagcgttgacggcactgggataccgggagacggcggttaagaaaatcaccgcgcaa
ttgcgtcagtttaatggtcaaacaaccaatgattacttgagtgaaggattgcggctgttg
actaaatag

DBGET integrated database retrieval system