KEGG   Lactobacillus brevis ATCC 367: LVIS_1276Help
Entry
LVIS_1276         CDS       T00406                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lbr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1249514..1250821)
Genome map
AA seq 435 aa AA seqDB search
MEKIIVHGGNRLSGVVHIEGAKNAVLPILAASILAQDGITHLANVPVLSDVYTMNKVLRF
LNLKVDFDEAKREVTIDATKQVSSEAPFEYVSKMRASIVVMGPLLARLGHARVALPGGCA
IGTRPIDLHLKGLEALGARIEQHDGYIEAFADRLQGAHIYLDFPSVGATQNILMAACLAK
GTTVIDNVAREPEIVDLANILNKMGANVRGAGTETIRVDGVDQMHGAEHSVVQDRIEAGT
FMVGAALTHGNVLIQDGIVEHNKPLISKLQEMGVQVTEEAAGIRVIGPDRLQPTDVKTLP
YPGFPTDMQPQMTILQLAAEGTSTMTETVFENRFMHLEELRRMNAQYQVNGRTVVMHGPT
DFNGAEVAATDLRAAAALVLAGLVADGYTQVTNLKYLDRGYYDFHKKLAALGAEVKRVSA
PDNDAVVLKNSHINN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattatcgttcatggtgggaaccgcttatctggtgtggttcatatcgaaggg
gccaaaaatgccgtgttgccaattttagcagcaagtattttggctcaggatgggatcacc
catttagcaaatgttccggttttgtctgatgtctatacgatgaataaggtcttacgcttc
ttgaatttaaaggttgactttgatgaagccaaacgagaagtgacgattgacgcaacgaag
caggtctcaagtgaagctccctttgagtacgtctcaaagatgcgggcctcaatcgttgtg
atgggaccgttgttagcgcgcttgggtcatgctcgtgtggccttgcccggtggttgtgcc
attggaacacgaccaattgacttgcatttgaagggtctagaggcgctgggagcgcggatt
gaacagcatgatggctatatcgaagcctttgctgatcgtttgcaaggtgcacatatttat
cttgattttccaagtgttggggctacgcaaaacatcctgatggctgcttgtttggccaag
ggcacaacggtgattgacaacgttgctcgcgaaccagaaattgttgatttggctaacatc
ttaaataagatgggggctaacgtacgtggtgctggcaccgaaaccattcgggttgatggt
gttgatcagatgcatggtgcggaacatagtgtggttcaagatcgtattgaagcgggaacc
ttcatggttggcgctgcgttgacgcacggtaacgtcttgattcaggatggcattgtggaa
cacaacaagccactgatttctaagctccaagagatgggcgttcaagtgacggaagaagct
gctggtatccgggttattggaccagatcgcttacaaccaacggatgtgaagacgctgcca
tatccgggctttccaaccgatatgcaaccgcagatgaccatcttacaattagccgctgaa
ggaaccagtacgatgaccgaaacggtgtttgaaaaccggttcatgcatcttgaggaactt
cgacggatgaatgcccagtatcaagtaaatggtcggacggttgtgatgcacggaccaact
gattttaatggtgctgaagttgccgcaactgatttacgggctgctgctgcattggtttta
gcggggctggttgctgacggttacacgcaagtgacgaatttaaaatacttagatcgaggc
tactatgacttccataagaagttggccgcgttaggagcagaagtgaaacgggtatctgca
cctgacaacgatgccgtcgttttaaagaattcgcacatcaataattag

DBGET integrated database retrieval system