KEGG   Lactobacillus brevis ATCC 367: LVIS_1421Help
Entry
LVIS_1421         CDS       T00406                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LVIS_1421
Enzymes [BR:lbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LVIS_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1392400..1393320)
Genome map
AA seq 306 aa AA seqDB search
MANKVTVLGSLNVDTTLRIARMPQPGETLSTENKSSAAGGKGANQAVAAARAGAETSFIG
KVGNDDAGRFMVESLDNDHIDTHAIITDPVVGTGSAFILLDEAGQNSILVYGGSNQQIKA
EEVIAREDEIANADFLITQFETPQAATLAAFKVAKQHGVTTILNPAPAAEIDPEILKVTD
LVIPNETESAELTGIEVTDEASMDANAKKFREMGVKNLIITVGSKGAYYATEQESGFVPA
FKVKAVDTTAAGDTFIGALSSQLKPDLSNVATALVFAQRASSLTVQGLGAMPSIPTVEQI
EAASKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaagtaacggttctgggaagtttgaatgttgatacgacgctacggatcgcg
cggatgccgcaaccaggggaaacattatcgactgaaaacaagagtagtgctgctggcggt
aagggtgccaaccaagcggtagctgctgcacgggccggagccgaaacaagctttattggt
aaggtggggaatgatgatgctggtcgtttcatggtagagtcattagataatgaccacatt
gatacacacgcaatcattaccgatccagttgtaggaaccgggtctgccttcattctcttg
gatgaagctggtcagaacagtatcttggtttatggtggttctaaccaacagattaaggcc
gaagaagtcattgctcgtgaagatgaaattgccaatgctgatttcttaattacccagttt
gaaacgccacaagcagcgaccttggcagcatttaaagtggctaagcaacacggggtaaca
actattttgaacccggcaccagctgctgaaattgatccagagattctaaaagtgacggat
ttggtcatccctaacgaaacggaaagcgcggagttaactggaatcgaggtaacagacgaa
gcctcaatggatgccaatgcgaagaagttccgagaaatgggtgttaagaacctgattatc
acagttgggagtaaaggcgcttactacgcaactgaacaggaatccggatttgtgccggcc
tttaaggttaaagctgtggatacgaccgcagctggagatacctttattggtgctttgagt
tcacaattgaagccagatcttagtaatgttgcaacggcgttggtcttcgcgcaacgggca
agttccttaacagtgcaaggtttgggtgctatgccatctatcccaacggttgaacaaatt
gaggccgctagcaagaagtag

DBGET integrated database retrieval system