KEGG   Lactobacillus brevis ATCC 367: LVIS_1431Help
Entry
LVIS_1431         CDS       T00406                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LVIS_1431
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LVIS_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1403556..1406081)
Genome map
AA seq 841 aa AA seqDB search
MATESLDLFATDNAGQPDFVVGTVSAVFFASNDSFYKVMLVKVSETSLDWHEDEIVVTGN
FADVKDDVTYRFTGKRVEHPKYGVQFQADNYQNETPTSRSGVIAYLSGDDFPGLGKKTAE
KIVDVLGTNAIEEILNDSAVLAPLGLSPKVTATLVSQLQTNNGMEQIIIGLNGYGFGSSL
AAAIYNRYQEKTLDVIHENPYQLAEDITGVSFKRADQIATQLGYAADRPERLQAGLLQTL
TDLSVANGDTYTTAKPLLNQALSLLENSRNVRLEPTKLADQLLELAKQQKVVGDDQRIYL
KALYDAEWQVAEHLQRLLQADTHQATFSDEAVAKQLRIVEKQADIVYDDSQTAALTAALQ
AKIMLLTGGPGTGKTTIIRGLVNLYARLHEVSLDINEYKDKPFPILLAAPTGRAAKRMSE
STGLPASTIHRLLGLTGRETDLDAATTKDLEGGLLIIDEVSMVDVYLMKTLLRAVPVGMQ
VILVGDKDQLPSVGPGQVFHDLLASDQLAKIQLDTIYRQGDGSSIIPLAHAIKAGKLPAD
FTQNHADRSFIACHANQVESVIDQIVAKAHAKGFSASDIQVLAPMYRGSAGIDRLNVVLQ
NILNPKKTARQKEVTFRNQQFRIGDKVLHLVNSPENNVFNGDIGTITGIDLASDKNSKVK
SDQLTIAFEQTEVTYARNDWIRLTLAYCMSIHKAQGSEFKLVILPMVSQYNRMLQRNLLY
TAVTRAADMLILLGEPQAFETCVTNLSVNRHTTLTTRIQTVLDPDKTATVSSKSVDDAQP
QPVAVAAPVAVADTSAPTTDHDAATATAQDYQLTPALVQARQIDPMIGMQGITPQQFMPS
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaatcactagacttatttgcaaccgataacgctgggcaaccagactttgtg
gtcggcactgtcagtgcggtcttttttgccagtaatgatagtttttataaggtgatgctg
gttaaggtttctgaaacgagtctggattggcacgaagatgagattgtggtgacgggcaac
tttgccgatgttaaggatgacgtgacgtaccgctttacgggtaaacgtgtcgaacatccc
aagtatggcgtacagtttcaagccgataactatcaaaatgaaacaccgacctcccgtagt
ggggtgattgcttatttaagtggtgatgatttcccgggactgggtaagaaaacggcagaa
aaaattgttgatgtgttgggcaccaacgcaatcgaagaaattctaaatgacagtgcggtg
ttagcgccattgggtttgtcacctaaagtgacggctacattggtgagccaattgcagacc
aataatgggatggagcagattatcattggcttgaatggatatggatttggtagctcgctc
gctgcagccatttataatcgatatcaagaaaaaactttggacgtcattcacgagaaccct
tatcagttagctgaggatattacgggagtcagcttcaaacgagccgaccagattgccacg
caactgggttatgccgcggatagaccagagcgactgcaggcgggactcttacagaccttg
acagatttatcggttgcgaatggggatacctacacaacggccaaaccactgttaaaccaa
gcgctgagcttgttggaaaattcgcgcaatgtgcgattagagccaactaagctggccgat
caactcttagaattggctaaacagcaaaaagtggtgggcgatgaccaacggatctacttg
aaggccctatacgatgctgagtggcaagtggctgaacatttgcaacggttgttacaagcg
gatacccatcaagcgacgttcagtgacgaggcggttgccaaacaactgcggattgttgaa
aagcaggccgatattgtctatgatgattcgcaaacggcggctttaacggcagccttgcaa
gcaaaaataatgctcctaaccggtggccctggtaccggaaaaacgacgattattcgtgga
ctggtgaacttatatgcccggctgcatgaggtctccttggatattaatgagtataaagat
aaaccctttccgattctgttagcggcccccactggtcgagcggctaaacgtatgagtgaa
tcaacgggattgccagcgtcaactattcatcggttattagggttaaccggtcgggaaaca
gatctcgatgcggctacgaccaaagatttagaagggggactgctgattattgacgaagtc
tccatggtcgatgtctatctgatgaagacgctgttgcgagcagttccggtggggatgcag
gtcatcttggtaggtgataaggatcagctgccatcagtcgggcctggtcaggtattccat
gatttactggcgagtgatcaattggcaaagattcaactggatacgatctatcggcagggt
gatggatcatccattattccgttagcacacgctatcaaggcgggaaagttaccagccgat
tttacccagaaccacgccgatcgctcctttatcgcgtgccatgccaaccaagtagaaagt
gtcattgatcagattgtcgctaaggcgcacgctaagggattctctgccagtgatatccaa
gtattggcgcccatgtatcgggggtcagcggggattgatcgactgaacgtggtgttacag
aatattttaaatccgaaaaaaacggcccggcaaaaggaagtcacttttcgcaatcaacag
tttcggattggagataaagtcttacacttggtcaacagtccggagaataatgtttttaat
ggtgatattgggacgatcacggggattgatttggcgagcgataaaaatagtaaagttaaa
agtgatcaattaacaattgcctttgaacaaaccgaggtaacctatgcacgtaatgattgg
attcggctgacgctagcctattgtatgtcgattcataaggcccaaggctcagagttcaaa
ctggtcattttgccaatggtgagccagtataatcggatgctccaacggaatctattgtat
acggccgtaacgcgagctgccgatatgttaattctactgggagaaccgcaggcgtttgaa
acctgtgtgacgaatttatccgttaaccggcatacaaccctgacaacgcggattcagacg
gtcttagatccagataaaacggcaacagtatcgtcaaagtcggttgatgacgcacaacca
caaccggtggcggtagctgcaccggttgcagtggccgatacttcggccccaacgaccgat
catgacgcggcaactgccacagctcaggactatcaattgacaccggcgctagttcaggcg
cgacagattgatccaatgattggcatgcaaggcattaccccgcaacaatttatgccatcg
ttataa

DBGET integrated database retrieval system