KEGG   Lactobacillus brevis ATCC 367: LVIS_1446Help
Entry
LVIS_1446         CDS       T00406                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  
cell division protein FtsZ
Organism
lbr  Lactobacillus brevis ATCC 367
Brite
Chromosome [BR:lbr03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LVIS_1446
Cytoskeleton proteins [BR:lbr04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   LVIS_1446
Prokaryotic defense system [BR:lbr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    LVIS_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1417848..1419107)
Genome map
AA seq 419 aa AA seqDB search
MEYSLDSAQNNGAIIKVIGVGGGGNNAVNRMIAEDVKGVEFIVANTDVQALEASKAETKI
QLGPKLTKGLGAGANPEVGAKAAEESEEAITEALDGADMVFVTAGMGGGTGNGAAPIVAK
IAKESGALTVGVVTRPFSFEGPRRGRFAAEGVAQMKENVDTLIVIANNRLLEIVDKKTPM
MEAFQEADNVLRQGVQGISDLITSPGYVNLDFADVKTVMKDQGAALMGIGSANGENRTED
ATKKAISSPLLEVSIDGAEQVLLNITGGPDLSLFEAQAASQIVSDAATSDVNIIFGTSID
EDLGDEVRVTVIATGIDKKKEEREAAHSRVARRAESQNRADNATETPAKETEKDPFGNWD
IREPAHRPEPTSSAANTNNEFAGVDKPDFNIFNPNQNDSSASDDNKSEDTPPFFKRRRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaatactcattagattctgcgcagaacaatggcgcaatcattaaagttatcggtgtc
ggtggcggtggaaacaatgcggttaaccggatgatcgcggaagacgttaagggtgtcgag
tttatcgtcgctaacaccgatgttcaagcacttgaggcctcaaaagccgaaaccaagatt
caattaggaccgaaattaacgaaaggacttggcgcgggtgccaatccagaagttggtgcc
aaggcagctgaagaaagcgaagaagcaattaccgaagccttggatggtgccgatatggtc
ttcgttactgccggaatgggtgggggtactggtaacggtgccgcaccgatcgtggctaag
attgccaaggaaagcggcgcgttaactgttggtgtcgtgacccgaccatttagttttgaa
ggcccacggcggggacggttcgctgctgaaggggttgcccaaatgaaggaaaacgttgat
acgttgatcgtcattgctaacaaccgcttattggaaattgttgacaagaagacgccaatg
atggaagccttccaagaagctgacaatgttttacgtcaaggggttcaaggcatctctgac
ttgatcacgagtcctggctacgttaacttggactttgctgatgttaaaacggttatgaag
gatcaaggtgcggccttaatgggaattgggtctgctaatggtgaaaaccggacagaagac
gcaaccaagaaggctatctcatcaccacttctggaagtgtcaattgatggggctgaacag
gtcctgttgaacatcactggtggtcccgacttgtccttgttcgaagcacaagcggcctca
caaattgtgtccgatgcggctacgagtgacgttaacattatcttcgggacatcaattgat
gaagatctgggcgatgaagttcgggttacggttattgccacaggaattgataagaaaaaa
gaagaacgcgaagcggctcacagtcgcgtagcacgacgggctgaaagccaaaaccgggct
gataatgcaaccgaaacaccagcaaaggaaaccgaaaaggatccattcggaaactgggac
attcgtgaaccagctcatcgaccagaaccaactagttcggcggctaacaccaataacgaa
ttcgctggggttgataaaccagattttaatattttcaatccgaaccagaatgatagctcg
gcttcagatgataacaagagtgaagatacaccaccatttttcaaacggcggcgtaagtaa

DBGET integrated database retrieval system