KEGG   Lactobacillus brevis ATCC 367: LVIS_1758Help
Entry
LVIS_1758         CDS       T00406                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LVIS_1758
  Lipid metabolism
   00561 Glycerolipid metabolism
    LVIS_1758
   00600 Sphingolipid metabolism
    LVIS_1758
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LVIS_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1715210..1717423)
Genome map
AA seq 737 aa AA seqDB search
MSIHVNEANLTFHLQTDHTSYIFQIMKNGEAGQIYYGPRIHVQPTYQNLMSQEWRDATPS
LNEENPNFQPATIKAEYASLGKGDFRQPAFQVTQANGSRITELTYDHYQLLTGKQRLANL
PSTFDDTDDDAQTLVVSFNDRITGLALDLNYSIFPHQDVIVKSAKFTNPSSEKLVLNRAL
SSQLDLPDANYDLIQFSGTWARERHLYRHPLRPGMQSISSLRMASSHQQNPFMMLARPQT
TDEQGAVFGFNLVYSGNFLDAIEVDQYSTSRILTGINPDEFGWNLAPQATFQTPEAILSY
TSAGMNQLSQQMASFYQQHLVNPRFAHEERPVLINNWEATYFDFNEAKLMTIVNQAKRLG
IEMFVLDDGWFGHRDDDTTSLGDWFVDQRKFPDGIEHFSQAVHQQGMKFGLWFEPEMVSV
DSDLYQQHPDWLIHAPKSTPTPGRHQFVLDMARPEVVDYLFKLMSQMIESANLDYIKWDM
NRYATEMFSSRLTSDQQLELPHRYILGVYQLYARLTQAYPNVLFESCASGGGRFDLGMMY
YAPQAWTSDDTDAAERLLIQFGTSYGYPQAMMGAHVSAVPNDQMGRITSLKTRGAVAFFG
DLGYELDITKMAPTELDQVKKQVAFYKCYRQLFQFGKFYRIDSPFVEDGNVTSWQVVSDD
QKQAIAARYQLLNHPNAPYTRFYFKGLRPNQRYQINDDPSTYYGDELMNAGYFVPTILAD
GQESKDFYTQLFVVTAI
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatccatgtcaatgaagctaatcttacgtttcatctacaaaccgatcacacgagt
tatatttttcaaattatgaaaaatggcgaggctggtcagatttattatggaccaagaatc
cacgtgcaaccgacctatcaaaatctcatgtcacaggaatggcgtgacgcgacaccgtca
ttgaacgaagaaaacccgaattttcagccagctacgatcaaggccgagtatgcgagcttg
ggcaagggcgatttccggcaaccggcttttcaagtgacccaagcaaatgggagccggatt
accgagttgacttatgatcattaccaactactaacagggaaacagcgattagccaacttg
ccatcaacgtttgatgataccgatgacgatgcccaaacattagtcgtgtcctttaacgat
cggattaccgggttggcacttgaccttaattacagtatttttccacaccaagatgtcatt
gtaaaaagtgcgaagtttaccaatccaagttccgaaaaattagttctgaatcgggcgctc
agttctcagttagatttgccggatgccaattatgacctaatccaattttctggtacgtgg
gcgcgtgaacggcatctgtaccgtcatccattacgaccgggaatgcagagtattagtagc
ctacggatggcctcaagtcaccaacaaaaccccttcatgatgttggcccgcccacagacg
accgacgagcaaggggcggtctttggcttcaatttagtttattccggtaattttttggat
gccattgaagttgaccaatacagtaccagccggattctgaccggaatcaatccagacgaa
tttggttggaatctggccccgcaagcgacatttcagactcccgaggcaattttgagttat
acctcagccggaatgaaccaactgtcacagcaaatggccagtttttatcagcagcatttg
gttaatccgcgatttgctcatgaggaacggccggtgctgattaataattgggaggccact
tactttgactttaacgaagcgaagttgatgacgattgttaaccaggctaagcgactggga
attgagatgtttgtgctggatgatggctggtttggccaccgggatgacgacaccacctcc
ttaggggactggtttgtcgatcagaggaagtttccggatggcatcgaacacttcagtcaa
gcagttcatcagcaagggatgaagtttggtttgtggtttgaaccggaaatggtttctgtt
gatagtgacctttaccaacagcatcccgactggttgattcatgcacccaaatcgacgcca
acgcctggtcgccaccagttcgttttggatatggcgcggccagaagtggtcgattaccta
tttaagctgatgagtcagatgattgaatcggcgaacttggactacatcaagtgggatatg
aaccgctatgcgacggaaatgtttagttcaaggttaactagtgatcagcaattagaactg
ccgcatcgatatattctaggcgtttatcagttgtatgcccgattaacgcaggcctatccg
aatgttttgtttgaatcctgtgcgtccggtgggggccggttcgatctggggatgatgtat
tatgcgccgcaagcgtggacgagtgatgatactgatgcggcagaacgcctgctgattcaa
ttcgggacgtcctatgggtatccacaagccatgatgggagcccacgtctctgcggttcca
aatgaccagatggggcggatcacgtcgctaaagaccagaggggccgtagcgttcttcggt
gatttggggtatgaactcgatattaccaagatggcgccaacggaattggaccaagtcaaa
aaacaagtggccttttataaatgttatcgccagcttttccaatttggaaagttttaccga
atcgacagtccctttgtggaggacggcaatgtcactagttggcaggttgtgagtgacgac
cagaaacaagcgattgccgcccggtaccaactgttgaatcatcccaatgcgccttatacc
cgcttctatttcaagggattacgtcctaatcagcgctatcaaattaatgatgacccatca
acctattatggggatgaattaatgaatgctggttattttgtcccaaccattttggcggac
ggccaagagtctaaagacttttatacccagttgtttgtggtgacggcaatttag

DBGET integrated database retrieval system