KEGG   Lactobacillus brevis ATCC 367: LVIS_2042Help
Entry
LVIS_2042         CDS       T00406                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LVIS_2042 (gpmA)
   01230 Biosynthesis of amino acids
    LVIS_2042 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_2042 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LVIS_2042 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LVIS_2042 (gpmA)
Enzymes [BR:lbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LVIS_2042 (gpmA)
Exosome [BR:lbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LVIS_2042 (gpmA)
  Exosomal proteins of melanoma cells
   LVIS_2042 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1998638..1999330)
Genome map
AA seq 230 aa AA seqDB search
MAKLVLIRHGQSEWNLENKFTGWVDVDLSEKGVEEAKAAGNKIKESGLKFDYAYTSVLKR
AIKTLHYVLEESDQLWIPETKTWRLNERHYGALQGLNKAETAEKYGDDQVHIWRRSYDVL
PPLLDADAEGSAVKDPRYANLDPNIVPGGENLKVTLERVMPFWEDEIAPKLLDGKNVIIA
AHGNSLRALSKYIERISDDDIMDLEMATGEPVVYDFDDKLNMTNKTKMGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagtactgattcgccacggccaaagtgaatggaacttggaaaacaagttc
actggctgggttgacgttgatttgagcgaaaagggtgtcgaagaagcaaaggcagccggt
aacaagatcaaggaatctggtttgaagttcgactacgcctacacttcagtattgaagcgg
gcaatcaagacgttacactacgttttggaagaatctgaccaactttggattccagaaacc
aagacttggcgcttgaacgaacgtcactacggtgctttgcaaggcttgaacaaggctgaa
acggctgaaaagtacggtgacgaccaagtgcacatctggcgtcggtcatacgacgtttta
ccaccacttttggacgctgacgctgaaggttcagctgtaaaggaccctcgttacgccaac
ttggaccctaacatcgtacctggtggcgaaaacttgaaggttactttggaacgggttatg
cctttctgggaagacgaaattgctcctaagttgcttgatggcaagaacgtcatcatcgct
gcccacggtaactcactccgggcactttccaagtacatcgaacggatctctgatgacgac
atcatggatcttgaaatggcaactggtgaaccagtggtttacgacttcgatgacaagtta
aacatgacgaacaagacgaagatgggtaagtaa

DBGET integrated database retrieval system