KEGG   Lactobacillus brevis ATCC 367: LVIS_2226Help
Entry
LVIS_2226         CDS       T00406                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LVIS_2226
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LVIS_2226
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LVIS_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2191843..2193375
Genome map
AA seq 510 aa AA seqDB search
MKKFQHEFWTATSGDLTQRRTPLATPDYQSTSAAAVKIIIDPADRHQPWLGGGAAITDSA
AYLLWSVMSAEQRRALLTELFDPDQGGFSSVRVPLGSCDFQSQDFYTYDDVPYGEHDQKL
EQFSIGTGQPGAPDATKDLKHIVPVLQEILAINPAVKVIASPWSAPAWMKNTGHLTHGGH
LRFGEFTGNGYTEENRFEYIYAQYFIRYIEAYQKLGIPIYGLTIQNEPSNAAHWPAMIWT
VPQLADFGYRYLRPALNHSFPDTKLYLLDDSFHALTKPITAEVTPEQAAAFDGLAVHTYS
GPYDNLYHANRAYPNWSTIMTERRCMMTDTPEEAAHIMFGIIGNWLVHNGLSMITLWNLA
LDERGLPNAADSTGREGVVTIDHTTGKVQRNLEYFMLRNFGQDVSVGATVIGSTNYTRDG
YTGGLGSVAFLGTAGDIAAHLYNPTAQPIQAAVTINGNGANWQLVTVPPYGTVTLHKSDA
PLNTTNVPVDDEFPLNPTPANHSDVAPGQH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttccaacatgaattctggaccgccacttccggcgatctaacgcagcgccgc
acaccgctagcaacacccgattatcaatcgaccagcgcggcggccgtgaaaatcatcatt
gaccccgccgaccgtcatcaaccatggttaggtggcggggccgctattacggactcagct
gcgtatctcttatggtccgtcatgagcgctgaacaacggcgtgccctgttaactgaacta
tttgatcccgatcaaggcggcttttctagcgtgcgggtgcctctaggatcttgcgatttt
caaagccaagatttttatacctacgatgacgtcccatatggtgaacacgatcagaagctg
gaacagttctccatcggtactggtcagccaggcgcaccagatgccaccaaagatttaaag
cacatcgtccccgtcctacaagaaattttggccattaatccggccgtgaaagtcattgct
tcaccatggtccgcccccgcatggatgaaaaacacaggtcatttgacccatggtggtcat
ctgcggtttggcgaattcactggcaatggctataccgaggaaaatcgtttcgaatatatt
tatgcccagtactttattcggtatattgaggcctatcaaaaactgggcatccccatctat
gggctcaccattcaaaatgaaccgtcgaatgccgctcactggccagctatgatttggacg
gttccccagctagctgactttggttaccgttatcttcgcccggcattaaaccacagtttc
cccgataccaaactttacctattagatgatagttttcatgcgttgaccaagccaattacg
gcagaagtcaccccagagcaggccgccgcatttgacggacttgccgttcacacctactcg
ggcccctatgacaatctctatcacgccaaccgtgcctatcccaattggtcgacaatcatg
actgaacgccgatgcatgatgaccgacacgcctgaggaagccgctcatattatgtttgga
attatcggtaattggttagttcacaacggtctcagtatgattaccttgtggaacctagcg
ctcgatgaacgaggtctgcccaacgccgcggattccactgggcgagaaggtgtcgtcacc
attgaccatacgaccgggaaagtccagcgtaacctggaatacttcatgctgcgaaacttc
ggtcaggatgttagcgtgggcgcaaccgtcattggttccaccaactatacccgtgatggc
tatacgggtgggctaggctctgtggcctttttaggaaccgctggcgacattgccgcacac
ctttacaacccaaccgcccaaccgattcaggccgccgtcaccattaatggtaacggtgct
aattggcaattggtcaccgttccgccatatgggaccgtcaccctgcacaagtcagatgcc
ccgcttaacaccacgaacgtgcctgtggatgatgaatttcctctgaatccaacacccgct
aatcatagtgatgtcgcccctggacagcattaa

DBGET integrated database retrieval system