KEGG   Lactobacillus brevis ATCC 367: LVIS_2269Help
Entry
LVIS_2269         CDS       T00406                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lbr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2243425..2244567
Genome map
AA seq 380 aa AA seqDB search
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQVIPYADGRANIIAEIGDT
TSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLA
DQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNY
HVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQV
NSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDS
PLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIVYGAGKWDAAHALNESVD
LDEFRHVQHVYQQLVEKFLS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagcgaacagattcagatcttacaacacttaattagtattaactcagtcaat
gatcatgaggctgacgtggccgcctacattcaacaactctttgccgaccatggcattacc
tcacaggttatcccctatgcagatggtcgcgccaatatcatcgctgaaatcggcgatacc
accagcgatcaagtctttgccttagccgggcacttagatacggttgccacgggcgatgtt
gctgactggaaatttgatcccttctcagcgcacattgtcgacaatcaactctacggtcgc
ggtgccgccgacatgaagagcggactggccgcgatggtgattaccttaatcaatttggct
gaccaacagacgcccttaactggacgcttacggtttattgggactgtcggcgaagaaaat
ggcgccatggggtcacgaatgttaaccgaaaagggcgtggcagatgatctcactgccatg
gtcattggcgaacccaccggtggtaatctggtctatgcgcacaatggttctttgaactat
cacgtctattctcgcggtgtcggcgcccacagttccatgcctgaaaagggaatcaacgcc
attacgaacctcatcaaatacgtcaccgcagaggcaactgcctttgacgacgcgcccgtc
agtccagaacttgggccactggtccacagcgtaacggtctttaatggtggcgaacaagtc
aacagtattcccgctaaggcggagctgcaaggaaatattcgccccattcccgaattcgat
aatactgccgtcattcaccgtctccatgaaacggtggatcggttaaatcaagagcctggt
gtcgatttagccttgcacgtagattacagctttaaacccattattagtgccaaagattcg
ccactggtgcaaacgaccaaggccattgccgaccaagaattcggtcacgcaatcgactta
caagtcattcacggggcaaccgacgcttcagaatttaccaaatccagtcatgacttcccg
gtcatcgtctacggcgctggtaaatgggatgccgctcacgccttgaatgaatccgtcgat
ctggatgaattccgtcatgttcaacacgtttatcagcaactcgttgaaaaatttcttagc
taa

DBGET integrated database retrieval system