KEGG   Lactobacillus brevis ATCC 367: LVIS_2269Help
Entry
LVIS_2269         CDS       T00406                                 

Definition
(GenBank) Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase related deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00300  Lysine biosynthesis
lbr01100  Metabolic pathways
lbr01120  Microbial metabolism in diverse environments
lbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LVIS_2269
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LVIS_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ABJ65317
JGI: LVIS2269
UniProt: Q03NA5
Position
2243425..2244567
Genome map
AA seq 380 aa AA seqDB search
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQVIPYADGRANIIAEIGDT
TSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLA
DQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNY
HVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQV
NSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDS
PLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIVYGAGKWDAAHALNESVD
LDEFRHVQHVYQQLVEKFLS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagcgaacagattcagatcttacaacacttaattagtattaactcagtcaat
gatcatgaggctgacgtggccgcctacattcaacaactctttgccgaccatggcattacc
tcacaggttatcccctatgcagatggtcgcgccaatatcatcgctgaaatcggcgatacc
accagcgatcaagtctttgccttagccgggcacttagatacggttgccacgggcgatgtt
gctgactggaaatttgatcccttctcagcgcacattgtcgacaatcaactctacggtcgc
ggtgccgccgacatgaagagcggactggccgcgatggtgattaccttaatcaatttggct
gaccaacagacgcccttaactggacgcttacggtttattgggactgtcggcgaagaaaat
ggcgccatggggtcacgaatgttaaccgaaaagggcgtggcagatgatctcactgccatg
gtcattggcgaacccaccggtggtaatctggtctatgcgcacaatggttctttgaactat
cacgtctattctcgcggtgtcggcgcccacagttccatgcctgaaaagggaatcaacgcc
attacgaacctcatcaaatacgtcaccgcagaggcaactgcctttgacgacgcgcccgtc
agtccagaacttgggccactggtccacagcgtaacggtctttaatggtggcgaacaagtc
aacagtattcccgctaaggcggagctgcaaggaaatattcgccccattcccgaattcgat
aatactgccgtcattcaccgtctccatgaaacggtggatcggttaaatcaagagcctggt
gtcgatttagccttgcacgtagattacagctttaaacccattattagtgccaaagattcg
ccactggtgcaaacgaccaaggccattgccgaccaagaattcggtcacgcaatcgactta
caagtcattcacggggcaaccgacgcttcagaatttaccaaatccagtcatgacttcccg
gtcatcgtctacggcgctggtaaatgggatgccgctcacgccttgaatgaatccgtcgat
ctggatgaattccgtcatgttcaacacgtttatcagcaactcgttgaaaaatttcttagc
taa

DBGET integrated database retrieval system