KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0183Help
Entry
LBUL_0183         CDS       T00419                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBUL_0183
Enzymes [BR:lbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LBUL_0183
Peptidases [BR:lbu01002]
 Cysteine Peptidases
  Family C44
   LBUL_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
172414..174363
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYYPEINDKQAAIGKMMATIQHRGPSSDGMYTNDKVALGFRRLSIIDLRCGSQP
IYNEDRSRAIIFNGEIYNFKPLREELIKAGHTFSTKADTEVILHGYEEWGMDGILKRVRG
MFAFIIWDDNTQTMYGARDFFGIKPMYYQDVDGHLLVGSELKSFLAFPHFKKELNTEAVK
PYLMNQYNDLKETFFKGVYRFQPGHWFEYKDGKMKTHQYWDAEYKDNNLSFEETVKKINE
DLKETVDLYRNADVKVGAFLSEGVDSSFLTALLDPDEVFSIGFDDNTYDEASKAKALADI
NGWHFYADKVYSEEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNNVIKVFTDKLKKLPKGKRVKLAHKIKKMPNFPGKVHLYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANAVLQPSYRNKLTVNGNYQEDFKKVKDLDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLELRVPYLDVKIAKLANSIPSKYLVNKYDTKYALRKASE
QVLPDEWAKRPKLGFPTPIKQWLQEERFYKQVRDLFSEDFVNDIFEQKKILDLLDENYNG
DGSHRRQIWVIYTFLVWYKLFFVDYEETVRKYQRVQPEVASLIAQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgccttttactatccagaaatcaatgacaagcaggcggccatcggc
aagatgatggctaccatccaacaccggggaccaagcagtgacgggatgtacaccaacgac
aaggtggcccttggtttcagaagactgtcgattatcgacctgcggtgcggtagtcagcca
atctacaacgaagaccgcagccgggcgatcattttcaacggggaaatctacaacttcaag
cccttaagagaggaactgatcaaggcgggccacaccttctccaccaaggccgacactgaa
gtcatcctgcacggctatgaagaatgggggatggacgggatccttaagcgggtccggggg
atgttcgccttcatcatctgggacgacaatacccagaccatgtacggggcccgggacttc
ttcggtatcaagccgatgtactaccaggacgtggacggtcaccttttggtcggctcagaa
ttgaagagctttttggcctttcctcattttaaaaaggaactgaataccgaagccgtcaag
ccatacctaatgaaccagtacaacgaccttaaggaaaccttcttcaagggcgtctaccgc
ttccagccaggtcactggtttgaatacaaggacggcaagatgaagacgcaccagtactgg
gatgccgaatacaaggacaacaacctttcctttgaagaaacagtcaagaagatcaacgaa
gacttgaaggaaacggttgacctttaccgcaacgccgacgttaaggtcggggccttcctt
agtgaaggggttgactccagcttcctgacggcccttttggacccggatgaagtcttctcc
atcggctttgacgacaacacctacgatgaagcttccaaggccaaggccctggccgacatc
aacggctggcacttctacgctgacaaggtctactcagaagaagctatgcgggacttcccg
gaaatgcagtaccacatggacgaaccagacgccaacccgtcaatcattcctttgtggtac
ctgtgcaaattggccagaaagcacgtgactgttgccctgtccggggaaggggccgatgag
ctttttgccggctatgtcaactacgggatgcacacccacaacaatgtcatcaaggtcttt
accgacaagctgaagaagctgccaaagggcaagcgggttaagctggctcataagatcaag
aagatgccaaacttcccgggcaaggtgcacctttacaccaacttggctgaaccaagcgaa
ttctacgtgggccagtcagtcatctacgacatggattacccgaccatcttcacttccaag
gacgctaacgctgtcttgcagccgagctaccggaacaagctgacggttaacggcaactac
caggaagacttcaagaaggtcaaggacctggacaatgtcaagcagatgcagtacatcgac
ctgcaccactttatgctcaacgacatcgagcagaaggctgacaagatttccatggcccac
tccctggaactccgggtgccttacctggacgtgaagatcgccaaactggccaactctatt
ccaagcaagtacctggtcaacaaatacgacaccaagtacgccctgcgcaaggcttcagaa
caggtcctgccggatgaatgggccaagcggccgaagctgggcttcccgacgccaattaag
caatggctgcaggaagagcgtttctacaagcaggtcagagacctcttcagcgaagacttc
gtcaatgatatttttgaacaaaagaagatcctggacctgctggatgagaactacaatggg
gacggttctcaccgccgacagatctgggtaatctataccttcctggtttggtacaagctc
ttcttcgttgactacgaggaaaccgtgcgcaagtaccagcgcgtgcagccggaagtggcc
agcttgatcgcccagggcaagctgctctaa

DBGET integrated database retrieval system