KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0203Help
Entry
LBUL_0203         CDS       T00419                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBUL_0203 (gpmA)
   01230 Biosynthesis of amino acids
    LBUL_0203 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUL_0203 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LBUL_0203 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUL_0203 (gpmA)
Enzymes [BR:lbu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBUL_0203 (gpmA)
Exosome [BR:lbu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBUL_0203 (gpmA)
  Exosomal proteins of melanoma cells
   LBUL_0203 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
195033..195722
Genome map
AA seq 229 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTR
AIKTLHFALEESGQLWVPETKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVL
PPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVMPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattc
actggttgggttgacgttaacttgtcagacaagggtgttgaagaagctaagaaggctggt
cgtttgatcaaggaagccggcttggaatttgaccaagcttacacttcagttttgacccgt
gcgatcaagactttgcactttgctttggaagaaagcggccaactctgggttccagaaact
aagtcctggagactgaacgaacgtcactacggcgctttgcaaggcttgaacaaggctgaa
actgctgaaaagtacggcgacgaacaagttcacatttggcgtcgttcatacgacgttttg
ccaccagttttggctgacgactcagaattcagccaagctaacgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacttgaaggttactctggacagagttatg
ccattctgggaagaccacattgctccagaccttttggctggcaagaacgtgatcatcgct
gctcatggtaactcactgcgtgccttgactaagtacatcgaaaacatctctgacgaagac
atcatggatgttgaaatgaagactggtgaaccagtcgtttacactttcgacgacaagttg
aacgttgtaagcaaggaaaagctggactaa

DBGET integrated database retrieval system