KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0209Help
Entry
LBUL_0209         CDS       T00419                                 

Definition
GTP cyclohydrolase I
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBUL_0209
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LBUL_0209
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LBUL_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
202233..203306
Genome map
AA seq 357 aa AA seqDB search
MMENVILSLGSNIGNREAHINKAVALLGNDPAILIDKASSFYETSPVGNVNQRAFINIAL
KIATTDSPEDLLTKIHQIELHLHRTRDVHWGPRTLDVDIIFWGDQKIKTESLIIPHPEAF
NRLFVLVPTLEIVTPEFPFYNQIKAQIQKLQKADQTIQLVQKQTQSKQVVESAIRQILNA
IGDDPDRPGLVETPDRVARMYNEIFSSEGLDNFEDYKLFNTKETDNSKMVMVKNIPFYSM
CEHHMMPFWGKAHIAYVPDHGKIIGLSKIPRLVDFVSHKLGLQEKLTDDIVAQMNRILAP
KGVAVIVDARHMCVEMRGVKKADSLTRTIRFFGVFETDQALRMAFLNSIGDVNGKTI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaatgtcattttaagtttaggtagtaatatcggtaatcgtgaagcccatatt
aacaaagccgttgcgttgttgggaaacgacccggctattttgattgataaagcttcaagt
ttttatgaaacttcaccggttggtaatgtgaaccagcgggcctttataaatattgcgctt
aaaatcgcaacaactgattcaccggaagacttgttaaccaaaatccaccaaatcgaattg
catttgcaccggacccgtgatgtacattggggaccgcggacattggatgttgatattatt
ttttggggtgatcaaaagattaagactgagtcgctgattattccgcatccggaagcattc
aaccgtttatttgtgctggtaccaacactggaaatcgtgacacctgaatttccattttat
aatcaaattaaggctcaaattcaaaaacttcaaaaagcagatcaaacaattcaacttgta
caaaagcagacgcaatctaaacaagtcgttgaaagcgcaattcgtcaaatcctgaatgcg
atcggagatgatccggatcgaccaggactggtggagacaccggatcgcgtcgcccggatg
tataatgaaattttttcgtctgaggggttggataattttgaagactataaattgtttaat
accaaagagactgataattcaaaaatggtgatggtgaaaaacattccgttttattcaatg
tgtgagcaccacatgatgccgttttgggggaaagcccacattgcttacgtacctgatcac
gggaaaattattggcttaagtaaaatcccgagactggttgattttgtatcacacaagttg
ggccttcaagagaagctgactgatgatattgttgcccaaatgaaccgaattctggcaccc
aagggagtggcggttattgttgacgcccggcacatgtgtgttgaaatgcggggagttaaa
aaggctgattcattaactcggacgattcgtttttttggtgtttttgagaccgaccaggcg
ttaagaatggcatttttaaactcgataggtgatgttaatgggaaaacaatctga

DBGET integrated database retrieval system