KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0211Help
Entry
LBUL_0211         CDS       T00419                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
204617..205708
Genome map
AA seq 363 aa AA seqDB search
MEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTELAA
VIKSWPEVFGAENGTLQQIQAASQIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGGRNA
SVDGVLKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKRFPNIVLA
IDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLVAKYKPAVVTMFNGRNFNEQTETLSK
TMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPIMIA
ISRKSFAKRLFNLESADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLKDQL
LLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaataaacaatcgtcaacaaacattcagcggcaacgtcaccatttct
tttaatgcgaatacagaagaattacccaaattaattaatctgttagctgaccagactgcc
aatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaattggcagct
gtaattaaaagttggccagaagtgtttggcgctgaaaacggtacgctgcagcaaatccag
gcagcttctcaaatccattttaagggtcggggatttgactttgatattacgaccaaacca
attatttattcgattttaaacttgacgccggattcattttacgatggtgggagaaacgct
tcagtcgatggggttctgaaacgaattgaagcagacctggcagccggaactgccatcttt
gaagtcggtggcaaatcttccaagccgcactttgatgatattagtgctgaagaggagtgg
gggcgaattaaaccgtttttggacgctattcacaagcgttttccaaatattgttttggca
attgattccaatacaaacgcggttattgaagaagcactaaaaaatggtattcaaattatt
aacgacatcgatggctttaattctcaagcaaaactgaatttagttgctaaatacaaacct
gctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaaccttatcaaaa
acaatgatggatttctttacacatacaattagcgatttaacaggcgttgggcttgaaaaa
gaaaacattgtgattgacccgggcgttggcttttctgatcataatacgttagcttttgat
ctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgattatgattgca
atttcgcgaaaaagttttgctaaacggctgtttaatttggaatcagcggatgatcgattg
attccaacgctgctatttgaagcatttatgacggttcttggcggtcgggttattcgggta
catgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaagatcagcta
ttgctaaagtaa

DBGET integrated database retrieval system