KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0258Help
Entry
LBUL_0258         CDS       T00419                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUL_0258
Enzymes [BR:lbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LBUL_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
252949..254346
Genome map
AA seq 465 aa AA seqDB search
MSVTDITTAGSLESPRYLTYTLDGKDGKVAGMFASSLPKGAKGKIFDNEYYPNHVAIDFY
HHYKEEIKMFADMGFKVFRTSIAWTRIFPTGEEDKPNQEGLDFYRRVFEELKKNGIEPLV
TISHYEDPLALGEKYNDWQDRKMIDLYVKYATTLFKEYKDLVKYWLTFNKINSSLMFLKL
VGDGKVSDADYQKAYQKLHHQFVASAKAVVAGHKINPDFMIGNMIAGSVYYPGTPDPKDA
LAARYEEELSQLYCADAQAKGEYPSFAKRLWDEHNVHLKIEDGDLEVMKEGKVDMYTFSY
YMSNMVTTHDVGEKAKGNFAAGAKTPYLEYYEWGWSTDPDGLQLYLEKMYDRYGIPMMVV
ENGLGAVDKLEDGTVHDDYRIDYLRKHIKAMDKAVEHGVDLRAYTTWGCMTAFLPELVKC
PSGMASYTLTVMTRAKVRLSACLRIHTTGTKRLSLQTAMNYKIKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtgactgacattaccacggccggctctttggaaagtccgcgttacctgacttac
actttggatggcaaggatggcaaagtagctgggatgttcgccagctccttgccaaagggc
gctaaggggaagatttttgacaatgaatactacccgaaccatgtagcgatcgatttttac
catcactacaaggaagaaatcaagatgttcgcggacatgggctttaaggtattcagaact
tccattgcctggacgcggattttcccaaccggtgaagaagacaagccaaaccaggaaggg
ctggacttttaccgcagagtctttgaagaactgaagaagaacgggattgaaccattagtt
acgatttcccactatgaagacccattggctttaggcgaaaagtacaacgactggcaagac
cgcaagatgattgacctctacgttaagtacgcgacgaccttgttcaaggaatacaaggac
ctggttaaatactggctgaccttcaacaaaatcaactcatccttgatgttcttgaagcta
gtgggtgatggcaaggtatctgatgcagattaccaaaaggcttaccaaaagctgcaccac
caattcgttgcttctgctaaggcagttgttgcaggccacaagattaacccagacttcatg
atcgggaacatgattgccggttctgtttactacccaggcacccctgatccaaaggatgct
ttggctgcccgctatgaagaagaattgagccagctttactgtgctgacgcgcaagctaag
ggtgagtatccaagttttgccaagcgcttatgggatgaacacaatgttcatttgaagatt
gaagatggcgaccttgaagtcatgaaggaaggtaaagttgacatgtacaccttctcatac
tacatgtcaaacatggttaccacccatgatgttggcgaaaaggctaagggcaacttcgct
gccggcgctaagaccccatatcttgaatactatgaatggggctggtcaactgacccagac
ggcttgcaactgtacttggaaaagatgtatgaccgttatggcatcccaatgatggtggtg
gaaaatggtcttggtgccgttgataagctagaagatggtactgttcatgacgattaccgg
attgactacttgagaaagcacatcaaggcgatggacaaggcagttgaacatggggttgac
ctgcgtgcctacacgacttggggctgcatgactgcgtttctgccggaactggtcaaatgt
ccaagcggtatggcttcatatacgttgaccgtgatgacaagggcgaaggtacgcttaagc
gcctgcctaaggattcatactactggtaccaaaaggttatcgcttcaaacggcgatgaat
tataaaattaaagcgtaa

DBGET integrated database retrieval system