KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0310Help
Entry
LBUL_0310         CDS       T00419                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lbu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lbu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297945..299216
Genome map
AA seq 423 aa AA seqDB search
MKKMIIHGGKPLQGDIWIGGAKNSTVALIPASILSRTPVTLESVPRIADVDNLMDLLSEM
DVHCDFRETTLQIDPTEIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIMGFQSLGADVRCENEQIVITAPDEGLKGAKIHLKMASVGATMNIIMASVTASG
RTVIENAAKEPEIIDLATFLNNMGAKIRGAGTDTIRIDGVDRLEAKVPHTIIPDRIEAGT
YISMAACIGNGIRIHNIIAEHLDAFLAKVEEMGVVIDTDEDSLFVYPAGDLRMVQVKTGT
YPGFATDLQQPITPLLLTAKTGEGVIIDPIYPKRTRHVPELQKMGAPITVVNNIILVQPG
SRLHGAVVHADEIRAGACLMLTGLMVDGETVINNAGNILRGYDRVEEKLRQLGADVVIRD
VED
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgataattcacggagggaaacccctgcaaggcgacatctggattggcggc
gcgaagaactcaacggtagcgctgattccggcctcaatcctgtcgagaacgccggtgacc
ctggaatcagttccgcgaattgccgacgttgacaatttgatggacttgttgagcgaaatg
gacgtgcactgcgacttccgcgaaacgaccctgcaaattgacccgactgaaatcaagatg
agtcccctgccagctgggaagattaagagcttgcgcgcgtcttactactttatgggcgct
ttgctcggtcgttttggcaaggcggttgtaggttttcctggtggcgatgacattggcccg
cggccgattgaccagcacattatgggcttccaatccctcggcgccgacgttagatgtgaa
aatgagcagattgtaattaccgcgcctgatgaagggttgaaaggggccaagattcacctg
aagatggcttctgttggggcaacgatgaacatcatcatggcctcagtcacggccagcggc
cggacggtgatcgaaaacgcggccaaggagccggaaatcatcgacctggcaactttcttg
aacaacatgggggccaagatccgcggggcggggactgacaccatcagaatcgacggggtt
gaccgcctggaggccaaggtgccgcacacgatcatccctgaccggattgaagccgggact
tacatttccatggcagcctgcatcggtaacgggatccggatccacaacatcatcgctgaa
caccttgacgcctttttggccaaggtggaagaaatgggcgtggtgatcgacactgatgaa
gactccctcttcgtttacccggccggggacctgcgcatggtccaggtcaagaccgggacc
tacccgggattcgcgactgacttgcagcagccaattacgccgctcttgctgacggctaag
accggggaaggggtcatcatcgacccgatctacccgaagcggacccggcacgtgccggaa
ctgcagaagatgggggctcccatcacggtcgttaacaacatcattctggttcaaccgggc
agccgcctgcacggggcggtggttcacgctgacgaaatccgggccggggcctgcttgatg
cttacgggcttgatggttgacggcgaaacggtgatcaacaatgccggcaacatcttgcgc
ggctatgaccgggtggaagaaaagctgcgccagctgggcgctgacgtggtcatccgggac
gtggaagattaa

DBGET integrated database retrieval system