KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0475Help
Entry
LBUL_0475         CDS       T00419                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBUL_0475
Enzymes [BR:lbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LBUL_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
445052..447454
Genome map
AA seq 800 aa AA seqDB search
MTADYDSKEYLKSVDAWWRAANYLSVGQLFLLKNPLLKEELTADDVKIKPVGHWGTIAPQ
NFIYAHLNRVIKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYSEIYPEISQDEAGMTKLFK
RFSFPGGVASHAAPETPGSIHEGGELGYTLSHATGAILDNPDVIAAAEIGDGEAETGPLA
AGWFSNRLINPVKDGAVLPILQVNGFKISNPTITARMSDEELTKYFEGMGWKPYFVSTFK
GGRFDGMKDIDQIHEEMAKTLDAIIEDIKAIQKNARENGDKSFAHWPLLIFQCPKGWTGP
KTDLDGNPIENSFRAHQIPLPVDQKHMDHKELLLDWLKSYKPEELFDETGYPTDLVLQNA
VHGDQRMAMNPVTNGGINPKRLNLPDWRDFAFEVGKPGSKDAQDMVEWAKYLTKVAELNP
TTFRGFGPDESKSNRLFDFLDSEKRQWESEIHEPNDENLAAQGRLIDSQLSEHQDEGMLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQYWRRDYPSLNFVATSTVFQQDH
NGYTHQDPGLLTHLFEKNRPDMIHEYLPADTNTLLAVADKAFRDREGINLLVTSKQERPQ
WFTPEEAAKLVNKGLGYIDWASTDKDAKPDVVFASTETEPTMETLAAIDILHQNFPDLKI
RYINVVDVMKLMAPKDNPAAISQEEFDRLFPTDVPTIFAWHGYKTMMESIWFARKRYNVS
IHCYEENGDITTAFDMRVLNHLDRFDLAKDAVEQIPALKDKSAAFIDKMDSLLSKHHAYI
RDHGEDIPEVTSWKWTGLDK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagattacgattcaaaagaatacttaaagagcgtcgacgcttggtggcgggcc
gccaactacttgtcagtcggccagttgttcctgctcaagaaccccttgcttaaggaagaa
ctgacggcagacgacgtcaagatcaagccggttggccactggggcacgatcgcgccgcag
aactttatctacgcccacttaaaccgggttatcaagaagtatgacttgaacatgttctac
atcgaaggttccggtcacggcggccaggtgatggtttccaactcatacctggacgggtct
tactctgaaatctacccggaaatcagccaagacgaagccgggatgaccaagctcttcaag
cgcttcagcttcccgggcggggtagcttcccacgcggctccggaaaccccgggttcaatc
catgaaggcggggaactgggctacactttgtcgcacgcgactggcgcgattctggacaac
ccggacgtgattgccgccgctgaaattggtgacggggaagctgaaaccggcccgctggct
gctggctggttctccaaccgcctcatcaacccggtcaaggacggggctgtcttgccaatc
ctgcaggttaacggctttaagatttccaacccaaccattactgcccgcatgagcgatgaa
gaactgaccaagtactttgaaggcatgggctggaagccttactttgtttcaactttcaag
ggcggccgctttgacgggatgaaggatattgaccagatccatgaggaaatggccaagacc
ctggatgccatcattgaagacatcaaggctattcaaaagaatgcccgtgaaaacggcgat
aaatcatttgcccactggccgctcttgatcttccaatgcccgaagggctggactggtcct
aagaccgatttggacggcaacccaattgaaaactccttccgggcccaccagattccgctt
ccggttgaccagaagcacatggaccacaaggaactgttgctggactggctgaagagctac
aagccggaagaactgtttgacgaaaccggctacccgactgacttagtcctacaaaacgcg
gttcatggtgaccaaagaatggctatgaacccagtaactaacggggggatcaatcctaag
cgcttgaatctgccagactggcgcgactttgcctttgaagttggcaagccgggctccaag
gacgcccaggatatggtggaatgggccaagtacctgaccaaggtggcagaactgaacccg
actactttccggggctttggcccggacgaatccaagtccaaccgcttgtttgacttcctg
gacagcgaaaagcggcaatgggaaagtgaaatccacgaaccaaacgatgaaaacctggcc
gcgcaaggccgtttgattgactcacaattgtcagagcaccaagatgaagggatgctggaa
ggctacgttttgactggccgccacggcttcttcgctacttacgaagcctttggccgggtg
gttgactccatgctgacccagcacatgaagtggctgcggaaggctaaggaacaatactgg
cgccgcgattacccatcattgaactttgtagctacgtcaactgtcttccagcaggaccac
aacggctacacccaccaggatccaggtcttttgacccacttgtttgaaaagaaccggccg
gacatgattcatgaatacctgccagctgacaccaacactttgttggctgtagctgataag
gccttccgtgaccgggaagggatcaacctgctggtaacttccaagcaggaacggccgcaa
tggttcactcctgaagaagctgccaagctggttaacaagggcctgggctacatcgactgg
gcttcaactgacaaggatgccaagccggacgtggtcttcgcttcaactgaaactgaaccg
accatggaaaccctggcagcgatcgacatcctgcaccagaacttcccagacttgaagatc
cgctacatcaacgtggttgacgtgatgaagctgatggcgccaaaggataacccagctgct
atttcccaagaggaattcgaccgcctcttcccaactgacgtgccaaccatttttgcatgg
catggctacaagaccatgatggaatccatctggtttgcccgcaagcgttacaacgtttca
attcactgctatgaagaaaatggtgacattaccacggcatttgacatgcgggtcttgaac
caccttgaccgtttcgacctggccaaggacgcggttgaacaaatcccagccttgaaggac
aagagtgctgccttcatcgacaagatggacagcctgctgtctaagcaccacgcttacatc
cgggaccacggtgaagacattccagaagtaacttcttggaagtggactggcctggacaag
taa

DBGET integrated database retrieval system