KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0498Help
Entry
LBUL_0498         CDS       T00419                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00040  Pentose and glucuronate interconversions
lbu00052  Galactose metabolism
lbu00500  Starch and sucrose metabolism
lbu00520  Amino sugar and nucleotide sugar metabolism
lbu01100  Metabolic pathways
lbu01130  Biosynthesis of antibiotics
Module
lbu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBUL_0498
   00052 Galactose metabolism
    LBUL_0498
   00500 Starch and sucrose metabolism
    LBUL_0498
   00520 Amino sugar and nucleotide sugar metabolism
    LBUL_0498
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBUL_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABJ58138
JGI: LBUL0498
Position
468624..469538
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSK
RAIEDHFDSNTELEDNLTEKHKDALLKLARETTMSNIKVNLYFTRQPHPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYHETHASTIAVMKVPHEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYIIDLGKKLESEGKKK
PAGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcattactggcagaagcaag
cgggcaatcgaagaccacttcgactcaaacacggaactagaagacaacttgactgaaaag
cacaaggacgcgcttttgaagctggcccgggaaaccaccatgtccaacataaaggttaac
ctttacttcacccggcagccgcatccaaatggcttgggggatgccgtcaaccgggctcgc
agctttatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctaccatgaaactcacgcttcaaccatcgcg
gttatgaaggtaccgcatgaagaagtcaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacctgtacaacgttaaggcctttgtggaaaagccagacgttgacaaggcc
ccaagtgacctggccatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggtgaaatccaattgactgacgccatcgacgccttg
aacaagacccagcgggtcttcgcccacgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacatggaaacttccatccaatacggtctccgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagaagctggaaagcgaaggcaagaagaag
ccagccggcaagtga

DBGET integrated database retrieval system