KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0498Help
Entry
LBUL_0498         CDS       T00419                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBUL_0498
   00052 Galactose metabolism
    LBUL_0498
   00500 Starch and sucrose metabolism
    LBUL_0498
   00520 Amino sugar and nucleotide sugar metabolism
    LBUL_0498
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBUL_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
468624..469538
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSK
RAIEDHFDSNTELEDNLTEKHKDALLKLARETTMSNIKVNLYFTRQPHPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYHETHASTIAVMKVPHEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYIIDLGKKLESEGKKK
PAGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcattactggcagaagcaag
cgggcaatcgaagaccacttcgactcaaacacggaactagaagacaacttgactgaaaag
cacaaggacgcgcttttgaagctggcccgggaaaccaccatgtccaacataaaggttaac
ctttacttcacccggcagccgcatccaaatggcttgggggatgccgtcaaccgggctcgc
agctttatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctaccatgaaactcacgcttcaaccatcgcg
gttatgaaggtaccgcatgaagaagtcaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacctgtacaacgttaaggcctttgtggaaaagccagacgttgacaaggcc
ccaagtgacctggccatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggtgaaatccaattgactgacgccatcgacgccttg
aacaagacccagcgggtcttcgcccacgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacatggaaacttccatccaatacggtctccgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagaagctggaaagcgaaggcaagaagaag
ccagccggcaagtga

DBGET integrated database retrieval system