KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0569Help
Entry
LBUL_0569         CDS       T00419                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lbu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lbu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
537163..537921
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNL
HVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETREAGKENEWVVSQIKAGLEGLTSEQVSKLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPNIDGGLVGGASLV
PDSYLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaccccaattattgctggtaactggaagctgaacatgaacccaaaggaaact
gttgagttcgtaaacgctgttaaggaccaattgccagacccatcaaaggttgaatcagtg
atttgtgcaccagcagttgacttggacgccttgctgaaggctgccgaaggctcaaacctg
cacgtcggtgcagaaaactgctactgggaaaactccggtgccttcactggtgaaacttct
ccagcagttttgaaggaaatgggcgtgcaatacgtcatcatcggccactcagaacgccgt
gactacttccacgaaactgacgaagacatcaacaagaaggccaaggctatctttgccaac
ggcttgactccaatcctttgctgcggtgaatcactggaaacccgggaagccggcaaggaa
aacgaatgggttgtcagccaaatcaaggctggcctggaaggcttgactagtgaacaagtt
tccaagctggtgatcgcttacgaaccaatctgggcgatcggcactggcaagactgcttca
agcgaccaagctgaagaaatgtgcaagactatccgggaaactgttaaggacttgtacaac
gaagaaactgctgaaaacgtccgcatccaatacggcggttcagtaaagccagccaacgtc
aaggaattgatggctaagccaaacatcgacggtggcttggttggtggtgcatcattggta
ccagactcatacctggctttggtaaactaccaagactaa

DBGET integrated database retrieval system