KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_0691Help
Entry
LBUL_0691         CDS       T00419                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBUL_0691
Enzymes [BR:lbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LBUL_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
641235..643625
Genome map
AA seq 796 aa AA seqDB search
MTEFSGEVKSVIYENAQNMYKILLVAVSQPLAGYDDDEIKVTGTFGDLELGQEYNFTGDL
VTHPKYGLQFQATGCQPALPKETGGVVKYLSSEKFPGIGPKTAEKIVDQLGSGGLKSLQA
DPTLIAKLDLSQKQKDSLLSGLAQMDSFDDLGMTLASYGIPRKVAGRLYQKYHDQTLKKL
QADPYLPLGEVTGYSFKQADHLGIGFGIALDSLERADGSILAVLLQALTMEGETYLELEE
LLPAAKELTNINFDRLAEAVNDLQDKKKVVVEEGRASLLAPFQVESEIVTDLEDLLAKGK
EADYREKDLDQAIKRAERKLGISYDPEQKQAIKNAVTSPVSILTGGPGSGKTTIIDGILL
VLKDLADMDEEEAEEAILLAAPTGRAAKRMEEVTGYPAKTIHRLLGLGIDNSEEMELNDL
EGEILIVDEMSMVDIYLFEKLLSAISNVHHLVFVGDKDQLPSVGAGKVFADLIEADFIPT
CQLQVVHRQKDDSTIIPLAHAVNEGANPAVLLQKTASYSFIPCRPHAVPSAVEQITQAAL
KSGFAADDIQVLGAMYRGDGGINSLNDTLQRVINPEKGNDKAVEAHGENFRLHDRVLQLQ
NDPERGIYNGEIGKVVAVDPEMLEDEDDEVKLLVNFDGNEVAYTQADLNNLTRAYAITIH
KSQGSEFPLVILCLTMQNYIMLKRNLLYTAITRASQKLVMVGEEQAFAQAMRVKGNERRT
NLVWLLKDRFKPEEQSKQESSDSTENTLDKEEKVEDYILTGARISRAEISPMVGMEGLVQ
GCKNLVEIVRTKGPGA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtttagcggtgaagtaaagagcgttatttatgaaaatgcgcaaaacatgtac
aagatcttgctggtcgccgtaagtcagcctctggccggctatgacgatgatgaaatcaag
gtgacggggaccttcggggacctggagcttggccaggaatacaactttaccggtgacttg
gtcacccaccccaagtacggcttgcagtttcaagcgactggctgccagccggccctgccg
aaagagactggcggggtggtcaagtacctgtcttctgagaagttccctggcatcgggccc
aagacggcggaaaagatcgttgaccagctgggcagcgggggcttaaagagcttgcaggct
gatccaaccttgatcgccaagctggatctttcccaaaagcaaaaagacagcctcttgtcc
ggcctggctcagatggattcctttgacgacctgggtatgactttggccagttacgggatt
ccccgcaaggtggccggccgcctttaccagaagtaccatgatcagaccttgaaaaagctg
caggccgatccctacctgcctttaggcgaagtgaccggctattccttcaagcaggccgac
cacttgggaattggctttggaattgcccttgacagtctggagcgggctgatggcagtatc
ctggcggttttgctccaggccttgaccatggagggggaaacctacctggaactggaagaa
cttttgccagccgccaaggaactgacaaatataaattttgaccgcctggcagaagcagtt
aacgacctgcaggacaagaagaaggtcgtcgtggaagaaggccgggccagcctgctggcc
ccatttcaagtggaaagcgagatcgtgaccgacctggaagaccttttagccaagggcaag
gaagcggactaccgggaaaaagacttggaccaggccatcaagcgggccgaaaggaagctg
gggatcagctatgaccctgagcaaaagcaggccatcaaaaacgcggtaaccagtccggtc
tccatcctgactgggggacccgggagcgggaagacgaccatcattgacgggatcttgctg
gtcttaaaggacctggccgacatggacgaagaagaagctgaagaagcgattctcctggcc
gcgccaaccggccgggcagccaagcggatggaggaagtcaccggctatccggccaagacc
atccaccgcctcttgggcctggggatcgacaacagcgaggaaatggagctgaatgatttg
gaaggggagatcttgatcgtcgacgaaatgtccatggtcgacatctacctctttgaaaag
ctgctcagcgccatcagcaatgttcaccacctggtctttgtcggtgacaaggaccaattg
ccatccgtcggggcggggaaggttttcgctgacttaatcgaggcggacttcattccgacc
tgccagttgcaggtggtccaccggcaaaaggacgattcaacgatcattcccctggcccac
gcggtcaacgaaggagccaacccggctgttctcttgcaaaagacggccagctactccttt
attccttgccggccccatgccgtgcctagcgccgtcgagcagatcacccaggcagcctta
aagagtggctttgcggctgacgacatccaggttctgggggccatgtaccgaggcgacggt
gggatcaacagtctgaatgacaccctccagcgggtgatcaacccggaaaagggcaatgat
aaagcagttgaggcccatggtgagaactttcgcctgcatgaccgggtcctgcagctgcaa
aatgacccggagcgggggatctacaacggcgagattggaaaggtcgtggccgttgacccg
gaaatgctggaagacgaggatgacgaagtcaagcttttggtcaattttgacggcaatgaa
gtggcttacacgcaggcggacttgaataacctgacccgggcctatgccatcaccatccac
aagtcccaggggtcagaatttcctttggtcattctctgcttaaccatgcagaactatatc
atgctcaagcgcaatcttttgtatacggccatcaccagggcttcccagaagctggtcatg
gtcggagaagagcaggcttttgcccaggccatgcgggtcaagggcaatgagcggcggacc
aacctggtctggctcttgaaggaccgctttaagccagaagaacaaagtaagcaagagagt
agtgactctacagagaatactctggataaagaagaaaaagtcgaagactacatcttgacc
ggggcccggatcagccgggcggagatttctcccatggttggcatggagggcctggttcag
ggatgcaagaatttggtggaaatcgtccggaccaagggaccaggagcctaa

DBGET integrated database retrieval system