KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1111Help
Entry
LBUL_1111         CDS       T00419                                 

Gene name
asnC
Definition
asparaginyl-tRNA synthetase (EC:6.1.1.22)
Orthology
K01893  
asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBUL_1111 (asnC)
Enzymes [BR:lbu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     LBUL_1111 (asnC)
Amino acid related enzymes [BR:lbu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   LBUL_1111 (asnC)
Transfer RNA biogenesis [BR:lbu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LBUL_1111 (asnC)
 Prokaryotic Type
    LBUL_1111 (asnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1024120..1025418
Genome map
AA seq 432 aa AA seqDB search
MTELISIRESSKHVDEEVRMHVWLTDKRSSGKIVFLQLRDGTAFFQGVVRKNDVSEEVFE
AAKGLRQEASFYLTGTIHEDARSHFGYEIQISDLEVVSNNEGYPITNKEHGIDFLLDHRH
LWLRSRRPFAIMQIRNRIFKATVDFFENEGFVKFDAPLLMHSAPEGTTELFHIDYFNHDA
YLSQSGQLYGEVGAEAFGKIFTFGPTFRAEASKTRRHLTEFWMMEPEMAWMHQDESLDLQ
ERFLSYVVGQVLEHCEYELSILGRDVDKLRPAAEGNYTRLSYDDAVKMLQEAGKDFKWGD
DFGAPDEAFLSEQFDRPFFIVNYPVAIKPFYMKKNPENPLTYLCADVEAPEGYGEIMGGS
EREADYDTLKAQIEEAGLNLDDYSWYLDLRKYGSVPHSGFGMGFERVIAWICKLDHVREA
VPFPRMINRMQP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattgatttcaattagagaatcaagcaagcacgttgacgaagaagtcagaatg
cacgtctggctgaccgacaagcggtccagcgggaagatcgtcttcctgcaattaagagac
ggcacggccttcttccaaggcgttgtccgcaagaacgatgtcagtgaggaagtttttgaa
gcagccaagggcctgcgccaggaagcaagcttctacctcaccgggaccatccatgaagac
gcccggtctcacttcggctacgaaatccagatcagcgacctagaagtcgtctcaaacaat
gaaggctacccgatcaccaacaaggaacacgggatcgacttccttttggaccaccgtcac
ctctggctgagaagcaggcggccattcgccatcatgcagatcagaaaccggatcttcaag
gccacggtcgacttctttgaaaacgaaggcttcgtgaagtttgacgccccgcttctgatg
cactcagcgccagaagggaccacggaactcttccacatcgactacttcaaccacgacgct
tacctgtcacaatccggccagctttacggggaagtcggggcagaagccttcggcaagatc
tttaccttcgggccaaccttccgggcggaagcttccaagacccgccgacacttgactgaa
ttctggatgatggaaccggaaatggcctggatgcaccaagatgaatccctggacttgcag
gaacgcttcctgtcttacgtggttggccaggttttggaacactgcgaatacgaattaagc
atcctgggccgggacgtagacaaattgcgtccagccgctgaaggcaattacacccgcctg
tcctacgatgacgcggttaagatgctgcaagaagctggcaaggacttcaagtggggcgac
gactttggcgcgccagatgaagccttcctgtcagaacaatttgaccggccattcttcatc
gttaactacccagtagcaatcaagccattctacatgaagaagaacccggaaaacccattg
acttacctctgcgccgacgtggaagcgccagaaggctacggggaaatcatgggcgggtca
gaacgtgaagctgactacgacaccttgaaggcgcaaatcgaagaagcgggcctcaacctg
gacgactactcctggtacctggacctgagaaagtacggcagcgtgccgcactccggcttc
gggatgggctttgaacgggttattgcctggatctgcaagctggaccacgttcgtgaagct
gtcccattcccaagaatgatcaacagaatgcagccataa

DBGET integrated database retrieval system