KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1111Help
Entry
LBUL_1111         CDS       T00419                                 

Gene name
asnC
Definition
asparaginyl-tRNA synthetase (EC:6.1.1.22)
Orthology
K01893  
asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lbu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1024120..1025418
Genome map
AA seq 432 aa AA seqDB search
MTELISIRESSKHVDEEVRMHVWLTDKRSSGKIVFLQLRDGTAFFQGVVRKNDVSEEVFE
AAKGLRQEASFYLTGTIHEDARSHFGYEIQISDLEVVSNNEGYPITNKEHGIDFLLDHRH
LWLRSRRPFAIMQIRNRIFKATVDFFENEGFVKFDAPLLMHSAPEGTTELFHIDYFNHDA
YLSQSGQLYGEVGAEAFGKIFTFGPTFRAEASKTRRHLTEFWMMEPEMAWMHQDESLDLQ
ERFLSYVVGQVLEHCEYELSILGRDVDKLRPAAEGNYTRLSYDDAVKMLQEAGKDFKWGD
DFGAPDEAFLSEQFDRPFFIVNYPVAIKPFYMKKNPENPLTYLCADVEAPEGYGEIMGGS
EREADYDTLKAQIEEAGLNLDDYSWYLDLRKYGSVPHSGFGMGFERVIAWICKLDHVREA
VPFPRMINRMQP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattgatttcaattagagaatcaagcaagcacgttgacgaagaagtcagaatg
cacgtctggctgaccgacaagcggtccagcgggaagatcgtcttcctgcaattaagagac
ggcacggccttcttccaaggcgttgtccgcaagaacgatgtcagtgaggaagtttttgaa
gcagccaagggcctgcgccaggaagcaagcttctacctcaccgggaccatccatgaagac
gcccggtctcacttcggctacgaaatccagatcagcgacctagaagtcgtctcaaacaat
gaaggctacccgatcaccaacaaggaacacgggatcgacttccttttggaccaccgtcac
ctctggctgagaagcaggcggccattcgccatcatgcagatcagaaaccggatcttcaag
gccacggtcgacttctttgaaaacgaaggcttcgtgaagtttgacgccccgcttctgatg
cactcagcgccagaagggaccacggaactcttccacatcgactacttcaaccacgacgct
tacctgtcacaatccggccagctttacggggaagtcggggcagaagccttcggcaagatc
tttaccttcgggccaaccttccgggcggaagcttccaagacccgccgacacttgactgaa
ttctggatgatggaaccggaaatggcctggatgcaccaagatgaatccctggacttgcag
gaacgcttcctgtcttacgtggttggccaggttttggaacactgcgaatacgaattaagc
atcctgggccgggacgtagacaaattgcgtccagccgctgaaggcaattacacccgcctg
tcctacgatgacgcggttaagatgctgcaagaagctggcaaggacttcaagtggggcgac
gactttggcgcgccagatgaagccttcctgtcagaacaatttgaccggccattcttcatc
gttaactacccagtagcaatcaagccattctacatgaagaagaacccggaaaacccattg
acttacctctgcgccgacgtggaagcgccagaaggctacggggaaatcatgggcgggtca
gaacgtgaagctgactacgacaccttgaaggcgcaaatcgaagaagcgggcctcaacctg
gacgactactcctggtacctggacctgagaaagtacggcagcgtgccgcactccggcttc
gggatgggctttgaacgggttattgcctggatctgcaagctggaccacgttcgtgaagct
gtcccattcccaagaatgatcaacagaatgcagccataa

DBGET integrated database retrieval system