KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1631Help
Entry
LBUL_1631         CDS       T00419                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00260  Glycine, serine and threonine metabolism
lbu00750  Vitamin B6 metabolism
lbu01100  Metabolic pathways
lbu01110  Biosynthesis of secondary metabolites
lbu01120  Microbial metabolism in diverse environments
lbu01230  Biosynthesis of amino acids
Module
lbu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBUL_1631
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBUL_1631
Enzymes [BR:lbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBUL_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP dCache_1
Motif
Other DBs
NCBI-ProteinID: ABJ59102
JGI: LBUL1631
Position
1509394..1510872
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTTAQAIVQGLAPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDDHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVV
YYFAAYKQLLDHEAIAFGDPVNFSVPTGNFGDILAGHYAQKLGLPVGRLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQNPDTVKSLMERLNTKGEYQLP
EDMQKKLSGFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQTVKEKGLPALKELTDLAGPAPKAMEAFLGHSSQEIVIPADN
MANEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccaggggcaggaagttaccactgcccaggcaatcgtc
caaggcctggccccagatggcggccttttcgtgcccaaagaattcccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagattctg
gctttgttcttaaccgactacagtgcagagcagctagcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacttggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacggccttggaaaactcagacgaccacagggggatcgtgattttg
acagcgacttccggggacaccgggaccgccgccatgcggggcttccagtccttagccaag
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagcttaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcgtc
tactacttcgccgcctacaagcagctgctggaccatgaagccattgcctttggcgatccc
gtcaacttctccgtgccaactggcaatttcggcgacattctggccggccattatgctcaa
aaactgggcctgccagtcggccgcctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactccccg
tccatggacatcctggtttccagcaacctggagcgcctgctctttgacctctgccagaac
ccggacacggtcaagtctttgatggagcggctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccggcttctgggccgactacgccactccggaagaaatc
gagggcgaaatcaagcgggtttacgaagaaagcggctatgtcatcgacccgcacacggct
gtcgcttctttagccgccaagcgctttaaggaagaagacgataagccaactgtcgtcctc
tctaccgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaact
gttaaggaaaaaggcctgccagcccttaaggaactgactgacctagccggccctgcccca
aaggccatggaggccttcttaggccacagctcccaggaaatcgtcatcccggctgataac
atggcaaacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system