KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1642Help
Entry
LBUL_1642         CDS       T00419                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBUL_1642
   01230 Biosynthesis of amino acids
    LBUL_1642
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUL_1642
   00030 Pentose phosphate pathway
    LBUL_1642
   00051 Fructose and mannose metabolism
    LBUL_1642
   00052 Galactose metabolism
    LBUL_1642
  Energy metabolism
   00680 Methane metabolism
    LBUL_1642
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBUL_1642
Protein phosphatases and associated proteins [BR:lbu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBUL_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1515173..1516252
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLAKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAIDIATRYLDDIHTTAQSHSRVFVVEVMGH
KVGHITLAAGLAAGSDIILLPEIPYDINVVAKKVKERQKSGKGFTVIAAAEGAISKEDAT
LSKKKYKAKVAARNGASVVNEIAAQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKTVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctggccaagaccctttacaactgtgtcgatgacgtggaaatcattggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagccgccatgaagaagacctacaagaag
ctcaacctagacgctttggcggttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgatcggcctgccaaagaccatcgacaacgacacttgg
gggactgactacaccttcggtttccaaagcgccattgatattgccaccagatacctggat
gacatccacactactgctcaaagccactcccgggtcttcgtcgtcgaagtcatgggccac
aaggttggccacatcaccctggccgccggcctggctgccggcagcgacattatccttttg
ccggaaatcccttatgacatcaatgtcgtggccaagaaggtcaaggaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgtccaagaagaagtacaaggctaaggttgccgctagaaacggcgccagcgtggttaac
gaaatcgctgcccaattgcaggaagttttgccagacgctgaaatcagaacggcggtcatc
ggccacgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggcgaagtcgactctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaagaccgtaagcaacgcccgccttatgggagtcacctttggggacaagtaa

DBGET integrated database retrieval system