KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1642Help
Entry
LBUL_1642         CDS       T00419                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBUL_1642
   00030 Pentose phosphate pathway
    LBUL_1642
   00051 Fructose and mannose metabolism
    LBUL_1642
   00052 Galactose metabolism
    LBUL_1642
  Energy metabolism
   00680 Methane metabolism
    LBUL_1642
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBUL_1642
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     LBUL_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1515173..1516252
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLAKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAIDIATRYLDDIHTTAQSHSRVFVVEVMGH
KVGHITLAAGLAAGSDIILLPEIPYDINVVAKKVKERQKSGKGFTVIAAAEGAISKEDAT
LSKKKYKAKVAARNGASVVNEIAAQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKTVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctggccaagaccctttacaactgtgtcgatgacgtggaaatcattggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagccgccatgaagaagacctacaagaag
ctcaacctagacgctttggcggttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgatcggcctgccaaagaccatcgacaacgacacttgg
gggactgactacaccttcggtttccaaagcgccattgatattgccaccagatacctggat
gacatccacactactgctcaaagccactcccgggtcttcgtcgtcgaagtcatgggccac
aaggttggccacatcaccctggccgccggcctggctgccggcagcgacattatccttttg
ccggaaatcccttatgacatcaatgtcgtggccaagaaggtcaaggaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgtccaagaagaagtacaaggctaaggttgccgctagaaacggcgccagcgtggttaac
gaaatcgctgcccaattgcaggaagttttgccagacgctgaaatcagaacggcggtcatc
ggccacgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggcgaagtcgactctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaagaccgtaagcaacgcccgccttatgggagtcacctttggggacaagtaa

DBGET integrated database retrieval system