KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1870Help
Entry
LBUL_1870         CDS       T00419                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
lbu00230  Purine metabolism
lbu01100  Metabolic pathways
Module
lbu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBUL_1870
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBUL_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 ABC_tran CPT dNK Zeta_toxin SKI Thymidylate_kin PRK AAA_23 AAA_17 RsgA_GTPase AAA_28 AAA_5 AAA_24 AAA_29 MMR_HSR1 Cytidylate_kin Rad17 AAA_14 T2SSE APS_kinase TsaE SRPRB RNA_helicase PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ABJ59270
JGI: LBUL1870
Position
complement(1697996..1698538)
Genome map
AA seq 180 aa AA seqDB search
MAKKIILIAGPSGAGKTTISEYLTDRYQIPRVITHTTRPKRPGESGSAYYFEDDDSFAQL
HFFEHVKYGDYQYGSSKEGLERAWAKNDLVSLIVDIKGARSYLEALGDQVYFLYVTCSLD
TLAQRMADRGDASDQIKKRLTGSELNELPEDLASCAHVLVNDDLQATYASLDNLVRKLQN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaagattatcttgattgccggtcccagcggggcaggcaagacgactatatct
gaatacctgaccgaccgctaccagatcccccgggtgattacccataccacccggccaaag
cggcctggggaaagcgggtcagcctattattttgaagacgatgattcttttgcccaactg
cacttctttgaacatgtcaaatacggggactaccagtacgggtccagtaaagaagggctg
gaaagagcctgggccaagaacgacctggtcagcttgatcgtggacatcaagggagcccgg
tcctacctggaagctttaggtgaccaggtttacttcctttatgtgacttgcagcctggat
accttggcgcaaagaatggctgaccggggtgatgcaagtgaccagatcaagaagcggctg
accggcagcgagttgaacgaattgccggaagatttggcttcttgcgcccatgtcctggtc
aatgacgacctgcaagcgacctatgccagcttggacaatttggtgagaaaattacaaaat
taa

DBGET integrated database retrieval system