KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365: LBUL_1941Help
Entry
LBUL_1941         CDS       T00419                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbu  Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBUL_1941
Enzymes [BR:lbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBUL_1941
Exosome [BR:lbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBUL_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1763685..1765193)
Genome map
AA seq 502 aa AA seqDB search
MSEQYILAIDEGTTSTREIIFNYAGQQVASVAREFTQYFPKPGWVEHQAEEIWNAVQITT
STALINSAIRPDQLAVIGITNQRETTVVWDKETGRPIYPAIVWQSRQTSDIAEKLVKDSY
SEMIRQKTGLVIAPYFSATKIRWILDHLEGAQERAEKGELLFGTIDTWLVWKLTRGKVHV
TDCTNASRTMLFNIHDLTWDQEILDLLKIPRTMLPEVKSNSEVYGETDPYQFFGGRVPIA
GMAGDQQAALFGQLAVKPGMVKNTYETGSFIVMNTGEEPIESKNNLLTTIGYKLGDQVNY
ALEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDANEVYVVPAFTGLGAPYWDSEA
RGAIFGLTRGSSDKDLIKATLQSLAYQTRDVVDTMQKDSGIEIPVLRVDGGASNNNYLLQ
FQADLLGKKIERAADLETTGLGAAFLAGLAVGYWQDLDSLKEIAKTGAAFAPKMEEAERD
RLYAGWQRAVLATRVFAHGKDF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaatacattttggcaatcgatgaggggacgacctcaaccagggaaatcatt
ttcaactatgccggccagcaggtggccagcgtggcccgggaattcacccagtacttcccc
aagcccggctgggtggagcaccaggctgaggaaatctggaacgcggtccagatcacgacg
tcaacggccctaatcaactccgccatccggccggaccaactggcggtcatcgggattacc
aaccaaagagaaaccacggtggtctgggataaggagacgggccggccaatctacccggcc
atcgtctggcagtcccggcaaactagcgatatcgcggaaaagctggttaaggacagctac
agcgagatgatccggcaaaagacgggcctggtgatcgccccttacttctccgccacgaag
atccgctggattttggaccatttggaaggggcccaggaaagggcggaaaaaggggagctg
ctttttggcacgatcgatacctggttggtctggaagctgacccggggcaaggtccatgta
actgactgcaccaatgccagccggaccatgctctttaacattcatgatttgacttgggac
caggagatcctggacctgctgaagattccgcggaccatgctgccggaggttaaatcaaat
tctgaagtctacggggaaactgacccttaccagttcttcggcggcagagtaccgatcgcc
gggatggccggggaccagcaggcggccttgtttggccaattggccgtcaagccgggcatg
gtcaagaacacctacgagaccgggtctttcatcgtgatgaacacgggggaggaaccgatt
gaatccaagaataatttgctgacgactattggctacaagctgggcgatcaagtaaactat
gctttagaagggtcagtcttcgtggccgggtcagccatccagtggctgagagactcagtc
aagctgctgaactcagccccggaatcagagcaggcggccctggaatcaaaagacgccaat
gaagtctatgtggttcccgcctttaccggtttgggggcaccatattgggacagtgaagcc
cggggggcgatttttggcctgaccagaggcagcagcgacaaggacttgatcaaggcaacc
ctgcagtccttggcctaccagacccgggacgtggtcgacaccatgcagaaggactcgggt
attgagattccggtcctcagagtcgacggcggggcttcaaacaacaactacctcctccag
ttccaggcagacctgttaggcaagaagatcgagcgggcagcggatttggaaacgactggc
ctgggggccgcttttctggcaggtttagccgtcggctactggcaagacctggatagcttg
aaggaaattgccaagaccggggccgcctttgcaccaaagatggaagaggcggaaagagac
cggctctacgcgggctggcagcgggcggttctggccacccgggtctttgcccacgggaaa
gatttttag

DBGET integrated database retrieval system