KEGG   Leadbetterella byssophila: Lbys_0079Help
Entry
Lbys_0079         CDS       T01350                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lby  Leadbetterella byssophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lbys_0079
Enzymes [BR:lby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Lbys_0079
Peptidases [BR:lby01002]
 Cysteine Peptidases
  Family C44
   Lbys_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
92736..94508
Genome map
AA seq 590 aa AA seqDB search
MLLDLYFLDSISSFYSHLGINVWFKGDNSNLGSLNRYEGDSCEEKIIHAFLAVNESCFKE
LKHEFLLVLQTEDCTYLVRDRFGVQSLYFCQESNKITVSDNLRILGKGKSPDSIEVYNYI
NFSISKESSINSGTFFSEVYQVPPSYYVKIDNDGNKLFRSYYSAVPKPFFIHSSSDVFRD
LLTKSIKRGLVNSQKIGSHLSGGLDSSVVTTLLRHVVSEDISCYYYDSGDTSHRDLDYAR
LVADNLDLPLHVVNTSGENIFTHQRWLCERTGFPEVFILPSTTHIELSEELREKGISRMF
TGIDGDSVVGHGLGYLQDLKSDGDWEKYLTLFVENFLAREYTSITLDAYKKKLIVKEVLT
LVRKNDWRSIAALLKSANLLWGYVPGSYLKVLLNKVISNVFSKLDLVPDPSLLNYSIGEL
SAESYYDIYDINNRELLENFRAVINGSYPYSFNQFNEISRFYNFEYKHPFFDQELFEFCL
GVPNEIRFGGGKTRWVMREAMNELLPQKLLNRTTKDDFSYYLISSFISLWNSNSEFFLDH
SSLWHWVNKKEFMRGISYVIKKGPHVKSNSLLARKLIRVLYLGIWLDTIQ
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggatctctattttctagatagcatttcgtctttttattctcacttaggtata
aatgtttggtttaaaggcgataattctaatctcggatctttaaacaggtacgagggtgat
agttgtgaagaaaaaataatccatgcatttttagctgtaaatgaaagttgttttaaagaa
ttaaaacacgagtttttattggttttgcaaacagaagattgcacctatttggtcagagac
cgatttggggtgcaatctttgtatttttgccaagagtcgaataaaattactgtttccgat
aatttaaggattcttggaaagggtaaatctccagattcgatagaggtatacaattatatt
aatttttcgatttctaaagagtccagtattaattctgggacttttttttctgaagtatat
caagtcccgccttcatattatgttaagatagataatgatggcaataaattatttagaagc
tactatagtgcggtacctaaacctttttttatacattctagctcggacgtgtttagggac
ttattgactaaatctattaagcgaggtctagtaaattctcaaaagataggttcacattta
agtggtggtctggattcttcagtagttacgacacttttaaggcatgtagtttcagaagat
atttcatgctactactatgatagtggtgacacaagtcatcgtgatttggattatgctaga
ttagtagctgataatttggacctgccactgcacgtggtcaatactagtggggaaaatata
tttacccatcagaggtggttgtgcgaaaggacaggttttcccgaggtttttattctgcca
tcaactacacatatagaactgagcgaggaattacgtgaaaaaggaatcagtcgaatgttt
actggtatagatggtgattctgtagtcgggcatgggctaggttatttgcaagatttaaag
tcagatggggattgggagaagtatttgactttatttgttgaaaattttttggctagagaa
tatactagtattacacttgatgcttataaaaagaaacttattgtcaaggaggtattaaca
ttagttaggaaaaatgactggaggtctattgctgcccttttgaaatcagcaaatctgctg
tgggggtatgttccaggttcttatttaaaagtattattaaataaagtaatatcgaatgtg
ttcagtaagcttgatttggtgccagatccatcattgctgaattattctataggtgaatta
tcagctgaatcttattatgatatatacgatataaataatagagaattattggaaaatttc
cgggcggttattaatggtagttatccttattcttttaatcaatttaatgaaatttctcgt
ttctataattttgagtacaagcatcctttttttgatcaagaactttttgaattttgccta
ggtgtacctaatgaaatacgatttgggggtggtaaaacgagatgggttatgagggaagca
atgaatgagcttttgcctcagaagctattaaatcgtacaacaaaggacgatttttcatac
tatttaataagttcttttatatctctttggaattctaattccgagttctttcttgatcat
agcagcctttggcattgggtaaataaaaaggaatttatgagggggatttcatatgttata
aagaaggggcctcatgttaaatcaaactctctcctcgcacgaaaattaattagggtcttg
tatctaggtatttggttagatactattcaataa

DBGET integrated database retrieval system