KEGG   Leadbetterella byssophila: Lbys_0352Help
Entry
Lbys_0352         CDS       T01350                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lby  Leadbetterella byssophila
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lbys_0352
  Lipid metabolism
   00600 Sphingolipid metabolism
    Lbys_0352
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lbys_0352
Enzymes [BR:lby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Lbys_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(364270..366849)
Genome map
AA seq 859 aa AA seqDB search
MKFQSKSGLAILFFALSPLLLYAQNYSINEGWTFKTEDTKEQKVSFPHTWNAMDAQDETP
GYSRTIGTYTRKLSTPASYAGKVVYLQFEGANQITEVFLDEKRVGKHQGGYTRFNFDLTP
YLRPGRTQELRIVVDNRHHVDIAPLSADFTFFGGIYRDVYLDVREDLHISPLDFASSGVY
VKTPKVSTSEAILEISTLINNHSSEKKEIQVLHTLKDPDGKVITSLTLKVDPEANTSNQR
VEGKIQVPKPRLWTPGTPFLYTVETKILEKGQLRDECTTKTGFRWFEFHADTGFHLNGKP
LKLIGTSRHQDFKDKGYALEDAHHIRDIELLKNMGGNFLRIAHYPQDPLILEMCDKLGIL
ASVEIPIVNAVTESAAFSNQSIFMAEEMVKQNTNHPSLIVWSYMNEVMLRPPYKNTEAAY
GPYCQEVYKQAKAIQDKIKQLDPSRPTMIAFHGNVKAYEDANLFTVPDIIGWNLYQGWYS
DRPEQLDTFLKKYREKYPSKPTILSEYGADVDVRIHTYSPERFDYSVEYGDLYHEHYLKT
ILNSPFLAGAAIWNLNDFYSEVRKNTIPHVNSKGISGLDRKPKNTYFLYQAHLLKQAFVR
FASKEWQQRPEGNHEIKIYSNASQVTLYLNNKKWGKLKVNAGIAKTHLNLPAGTHTLRAH
ISGAEDSFEIHTLPSQNFNELNVALGSKRFFWDENTKTLWQPEKAYEPGSYGFIGGQALR
PKTRYGELPTAEVRIKGTDLSPLFLTQRIGIEKFKADLPAGKYAVYLYWAELNGTEPADA
IAYNLGNDAIQELAGKRSFNVKANGVSFLENYEIDKEAGIQQAAVKKFNIDVKENGLTIE
FIPIEGTTLLNAIKIIKRD
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccaatccaaatcaggactggctatccttttttttgccttatctcccctactg
ctatacgcccaaaactacagtattaatgaagggtggacctttaaaaccgaggatactaaa
gaacaaaaagtctccttcccacacacctggaatgctatggacgctcaggatgaaaccccc
ggctattccaggaccattggcacctatactaggaaactctctacccctgcctcctatgcc
gggaaagtggtatacctccagtttgaaggagcaaatcagattacagaagtattcctagac
gaaaaacgtgtgggaaagcatcagggcggttacacacgtttcaactttgatttaacccct
tatctccgtcccgggcgaacgcaggaattgagaatagtggtggataaccgccaccacgtg
gatattgcccccttaagcgctgacttcactttctttggaggaatctaccgtgatgtctac
ttagacgtgagagaagacctgcatatctcacctttggattttgccagttctggagtttat
gtcaaaacgccaaaagtatccacttctgaagctattttggaaataagtacacttataaat
aaccatagttcagaaaaaaaagagatacaggtattacataccttaaaggatcctgatggg
aaagtgataacatcgctcactttgaaagttgatcccgaagccaatacttctaaccagcga
gtagagggcaaaatccaagttcctaaacctcgtctttggactcctggtaccccctttctc
tatacagtagagacaaaaatccttgaaaaagggcaacttagagatgaatgcacgacaaaa
accgggtttagatggtttgaatttcatgcagacacaggctttcatctaaacgggaagcca
ctaaagctgataggaacctcccggcaccaagacttcaaagacaagggatacgccttagaa
gacgctcaccatatcagagacatagaacttttaaagaatatgggaggtaatttcttacgg
attgcccactatcctcaagatccgctgatcttggaaatgtgtgacaaactgggtatattg
gcttcagtagagatacccattgtaaatgctgtcacggaaagtgctgccttttccaaccag
tccatatttatggcagaagaaatggttaagcaaaacaccaatcatccttccttgatagta
tggtcctatatgaacgaggtcatgctccgccctccctataaaaatacagaagcagcttac
ggtccctattgccaggaagtatataagcaggccaaagccatacaggataagatcaaacag
ctggatccttcccgtcctaccatgatagccttccacggcaacgtaaaggcttacgaagat
gccaacctattcactgttccggatatcattggatggaacctgtatcaaggttggtacagc
gatagacctgagcaactcgacactttcctgaagaaatacagagaaaaatacccttccaag
cccactatactctctgagtatggggcggacgtggacgttagaattcacacctattcacca
gaacgctttgattacagtgtagaatatggagatctatatcatgaacattacttgaagacc
attcttaactcacctttcctggcaggagcagccatctggaacctcaatgacttctattca
gaagtaagaaagaacacgatacctcatgtaaatagcaaaggaatctcaggactggacaga
aaacctaaaaatacctatttcctctatcaagcgcacttgttaaagcaagcttttgtacgt
tttgcatccaaagagtggcaacaaagaccagagggtaatcatgagataaaaatctattct
aatgcaagccaggtcactttgtacctaaacaataaaaaatggggcaaattaaaagtcaat
gcagggattgccaaaacccatttgaaccttcctgcaggaactcacaccttaagagcgcat
atttcaggggctgaggacagctttgaaatccataccttaccttctcaaaactttaatgag
ctaaatgtggcactaggaagcaagaggtttttttgggacgagaacaccaaaaccctttgg
caaccggagaaagcctatgaacctggaagctacggtttcataggtggtcaagcacttcgc
cctaaaacccgctacggcgaacttcctacagcagaagtaagaatcaaaggcacagatttg
agccccttgtttctcacgcaaagaataggaattgaaaaattcaaagccgatcttcctgcc
ggaaaatacgccgtttacctatattgggcagaattaaacggcaccgaaccggcagatgca
attgcctacaatctaggcaatgacgctatccaggaactagcaggcaaaagaagctttaat
gtaaaagcaaatggagtgtccttcttggaaaactacgagatcgacaaagaagcgggtatc
caacaagcagccgttaagaaattcaatatagacgtgaaagagaatggcctcaccatagag
tttatccctattgaaggcactaccttgttaaacgcaatcaaaataatcaaaagggactga

DBGET integrated database retrieval system