KEGG   Leadbetterella byssophila: Lbys_0352Help
Entry
Lbys_0352         CDS       T01350                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lby  Leadbetterella byssophila
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lby00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lby00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(364270..366849)
Genome map
AA seq 859 aa AA seqDB search
MKFQSKSGLAILFFALSPLLLYAQNYSINEGWTFKTEDTKEQKVSFPHTWNAMDAQDETP
GYSRTIGTYTRKLSTPASYAGKVVYLQFEGANQITEVFLDEKRVGKHQGGYTRFNFDLTP
YLRPGRTQELRIVVDNRHHVDIAPLSADFTFFGGIYRDVYLDVREDLHISPLDFASSGVY
VKTPKVSTSEAILEISTLINNHSSEKKEIQVLHTLKDPDGKVITSLTLKVDPEANTSNQR
VEGKIQVPKPRLWTPGTPFLYTVETKILEKGQLRDECTTKTGFRWFEFHADTGFHLNGKP
LKLIGTSRHQDFKDKGYALEDAHHIRDIELLKNMGGNFLRIAHYPQDPLILEMCDKLGIL
ASVEIPIVNAVTESAAFSNQSIFMAEEMVKQNTNHPSLIVWSYMNEVMLRPPYKNTEAAY
GPYCQEVYKQAKAIQDKIKQLDPSRPTMIAFHGNVKAYEDANLFTVPDIIGWNLYQGWYS
DRPEQLDTFLKKYREKYPSKPTILSEYGADVDVRIHTYSPERFDYSVEYGDLYHEHYLKT
ILNSPFLAGAAIWNLNDFYSEVRKNTIPHVNSKGISGLDRKPKNTYFLYQAHLLKQAFVR
FASKEWQQRPEGNHEIKIYSNASQVTLYLNNKKWGKLKVNAGIAKTHLNLPAGTHTLRAH
ISGAEDSFEIHTLPSQNFNELNVALGSKRFFWDENTKTLWQPEKAYEPGSYGFIGGQALR
PKTRYGELPTAEVRIKGTDLSPLFLTQRIGIEKFKADLPAGKYAVYLYWAELNGTEPADA
IAYNLGNDAIQELAGKRSFNVKANGVSFLENYEIDKEAGIQQAAVKKFNIDVKENGLTIE
FIPIEGTTLLNAIKIIKRD
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccaatccaaatcaggactggctatccttttttttgccttatctcccctactg
ctatacgcccaaaactacagtattaatgaagggtggacctttaaaaccgaggatactaaa
gaacaaaaagtctccttcccacacacctggaatgctatggacgctcaggatgaaaccccc
ggctattccaggaccattggcacctatactaggaaactctctacccctgcctcctatgcc
gggaaagtggtatacctccagtttgaaggagcaaatcagattacagaagtattcctagac
gaaaaacgtgtgggaaagcatcagggcggttacacacgtttcaactttgatttaacccct
tatctccgtcccgggcgaacgcaggaattgagaatagtggtggataaccgccaccacgtg
gatattgcccccttaagcgctgacttcactttctttggaggaatctaccgtgatgtctac
ttagacgtgagagaagacctgcatatctcacctttggattttgccagttctggagtttat
gtcaaaacgccaaaagtatccacttctgaagctattttggaaataagtacacttataaat
aaccatagttcagaaaaaaaagagatacaggtattacataccttaaaggatcctgatggg
aaagtgataacatcgctcactttgaaagttgatcccgaagccaatacttctaaccagcga
gtagagggcaaaatccaagttcctaaacctcgtctttggactcctggtaccccctttctc
tatacagtagagacaaaaatccttgaaaaagggcaacttagagatgaatgcacgacaaaa
accgggtttagatggtttgaatttcatgcagacacaggctttcatctaaacgggaagcca
ctaaagctgataggaacctcccggcaccaagacttcaaagacaagggatacgccttagaa
gacgctcaccatatcagagacatagaacttttaaagaatatgggaggtaatttcttacgg
attgcccactatcctcaagatccgctgatcttggaaatgtgtgacaaactgggtatattg
gcttcagtagagatacccattgtaaatgctgtcacggaaagtgctgccttttccaaccag
tccatatttatggcagaagaaatggttaagcaaaacaccaatcatccttccttgatagta
tggtcctatatgaacgaggtcatgctccgccctccctataaaaatacagaagcagcttac
ggtccctattgccaggaagtatataagcaggccaaagccatacaggataagatcaaacag
ctggatccttcccgtcctaccatgatagccttccacggcaacgtaaaggcttacgaagat
gccaacctattcactgttccggatatcattggatggaacctgtatcaaggttggtacagc
gatagacctgagcaactcgacactttcctgaagaaatacagagaaaaatacccttccaag
cccactatactctctgagtatggggcggacgtggacgttagaattcacacctattcacca
gaacgctttgattacagtgtagaatatggagatctatatcatgaacattacttgaagacc
attcttaactcacctttcctggcaggagcagccatctggaacctcaatgacttctattca
gaagtaagaaagaacacgatacctcatgtaaatagcaaaggaatctcaggactggacaga
aaacctaaaaatacctatttcctctatcaagcgcacttgttaaagcaagcttttgtacgt
tttgcatccaaagagtggcaacaaagaccagagggtaatcatgagataaaaatctattct
aatgcaagccaggtcactttgtacctaaacaataaaaaatggggcaaattaaaagtcaat
gcagggattgccaaaacccatttgaaccttcctgcaggaactcacaccttaagagcgcat
atttcaggggctgaggacagctttgaaatccataccttaccttctcaaaactttaatgag
ctaaatgtggcactaggaagcaagaggtttttttgggacgagaacaccaaaaccctttgg
caaccggagaaagcctatgaacctggaagctacggtttcataggtggtcaagcacttcgc
cctaaaacccgctacggcgaacttcctacagcagaagtaagaatcaaaggcacagatttg
agccccttgtttctcacgcaaagaataggaattgaaaaattcaaagccgatcttcctgcc
ggaaaatacgccgtttacctatattgggcagaattaaacggcaccgaaccggcagatgca
attgcctacaatctaggcaatgacgctatccaggaactagcaggcaaaagaagctttaat
gtaaaagcaaatggagtgtccttcttggaaaactacgagatcgacaaagaagcgggtatc
caacaagcagccgttaagaaattcaatatagacgtgaaagagaatggcctcaccatagag
tttatccctattgaaggcactaccttgttaaacgcaatcaaaataatcaaaagggactga

DBGET integrated database retrieval system