KEGG   Leadbetterella byssophila: Lbys_0371Help
Entry
Lbys_0371         CDS       T01350                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lby  Leadbetterella byssophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lbys_0371
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Lbys_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395765..396679
Genome map
AA seq 304 aa AA seqDB search
MQNVSKSKIVVVGSSNTDMVIKASRLPVPGETVIGGEFMMNPGGKGANQAVAVARMGGQV
TFITKTGNDLFGRQSMELYNSENINTDYVFSDEDHPSGVALISVDVYGENCILVAPGANA
ALTTADIEKARKEIEEAEILLMQLEIPMETVEYAAKIAAEKGVKVALNPAPAQTLSNELL
KCLYIITPNKNEAEILSGIKVRDWDSAQKSADRISEKGVDIVVVTLGGLGALIKEGSSYY
RVEAEKVEAMDTTAAGDTFCGTLCVGLSEGMSIEEAVRMACKASAITVTRMGAQASLPYR
HELT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaacgtgagtaagtcgaaaatagtggtggtaggcagttcgaatacggatatggtg
attaaagccagtcgactgccggtacccggagaaaccgtgataggtggtgaatttatgatg
aatccgggtgggaaaggtgcgaatcaggccgttgccgtggcaagaatgggcggtcaggtc
acttttattaccaaaacaggtaatgaccttttcggtagacaatctatggaattatacaat
tcggaaaatattaacacagactatgtgttttcggatgaagatcatccttcgggtgtggca
ttgatttctgttgatgtttacggtgaaaactgtattctcgtagctcctggtgcgaacgct
gccttaaccacagcggatatagaaaaagcccgcaaagaaattgaagaagcagagatcctt
ttgatgcagttggaaatcccaatggaaacggtagaatatgcggctaaaatagcggcagaa
aagggagtaaaagtagctctcaatcctgctcctgctcaaaccctctctaatgaattatta
aaatgcttgtacatcatcactccaaataagaacgaagctgagattctttccgggattaaa
gtgagggattgggactctgcccaaaaatcggcagatagaatcagcgagaagggtgtggat
atagtagtagttactctagggggattgggcgctttgattaaagagggttcttcctattac
agagtagaagcagagaaggttgaagccatggataccaccgcagccggagatactttctgt
ggcacattgtgcgtgggtctaagtgagggtatgagcatagaggaggccgtaagaatggct
tgcaaggcttcagctatcaccgttacccgcatgggagctcaagcatctctaccttataga
cacgaattaacctaa

DBGET integrated database retrieval system