KEGG   Leadbetterella byssophila: Lbys_0587Help
Entry
Lbys_0587         CDS       T01350                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
lby  Leadbetterella byssophila
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Lbys_0587
   00500 Starch and sucrose metabolism
    Lbys_0587
Enzymes [BR:lby01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Lbys_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
629116..630039
Genome map
AA seq 307 aa AA seqDB search
MKTLILLLISFPLFAKDLVVAPDGSADYRTIQEAVMAVRDHSQEKVKIIIKEGVYPEKLV
IPSWKPNLHLVGEGKVRIIGDDYSGKPLPTRDPVGNSTFVTYTTYVVLVDADNITFENLT
IENIAGPISQAVALHVEGDKFEARNCTFLGNQDTLFASREGTMQYYVDCRIEGTTDFIFG
KAMAVFERCVIHSKKKSYITAAATPKGQAYGFVFLDCTLTADHAIKDVYLGRPWRPYAQT
VFIRTDMGGHIHPDGWDNWRDPENEKTVLYGEYGSKGAGGGKRRVKWAKTITNLEQYTVR
EIFKGWK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttaattctacttttaattagttttcccctttttgcgaaagatttagtggtt
gcacccgacggtagtgcggattatcggaccattcaggaggccgtcatggcagtgagggat
cacagccaggagaaagtaaagatcatcatcaaagaaggtgtctatcctgagaagttggtt
attccttcctggaaacctaacctgcatttagtaggagaaggtaaggtaaggataataggg
gatgattactctggtaagccgcttcctacgagggaccctgtgggtaattctacctttgtg
acatataccacttacgtggttctagtggatgcagataacatcacttttgaaaatctgacc
atcgaaaacatagcaggtcctatcagtcaagcggtggccttacacgtagaaggcgataag
tttgaagccaggaattgtacatttttagggaatcaagatacactttttgcttcgagagaa
ggtaccatgcaatattatgtggattgtagaatagaaggcacaaccgactttattttcggt
aaagctatggcagtttttgagcgttgtgtcattcatagcaaaaagaaatcctatatcact
gcagcggcaacacctaaagggcaggcgtacggctttgtttttttggattgtaccttaacg
gctgaccacgcaattaaagacgtatatctaggtaggccatggagaccctatgcacagacg
gtttttattcgtactgatatgggtggacatatccatcctgacggttgggataactggaga
gaccccgagaatgagaagacggtgttatatggagaatatggatccaaaggtgctggggga
ggaaagagacgcgtgaaatgggccaagactataaccaatctagagcaatacaccgtaaga
gagatattcaagggatggaaatga

DBGET integrated database retrieval system