KEGG   Leadbetterella byssophila: Lbys_0642Help
Entry
Lbys_0642         CDS       T01350                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lby  Leadbetterella byssophila
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lbys_0642
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lbys_0642
Enzymes [BR:lby01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Lbys_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691272..692198
Genome map
AA seq 308 aa AA seqDB search
MQQAISTRHLLGIKNITAQDIELILETAKSFKEVINRPIKKVPSLRDITIANLFFENSTR
TRLSFELAEKRLSADTINFTSSGSSVKKGETLLDTVNNILAMKVDMVVMRHSSPGAPHFL
SDKIKANIVNAGDGTHEHPTQALLDSFSMQERLGDLAGKRIAIIGDITHSRVALSNIFCL
QKLGAEVAVCGPTTLIPKYLHTLGVKRFDTVGEALRWCDVANVLRIQLERQQLKFFPSLR
EYSLYYGITKKMLDELDKEIIVMHPGPINRGVELSSDAADSGHSIILDQVENGVAVRMAV
MYLLAQKN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggccataagtactagacatttgctgggcataaagaacatcacggcccaagat
atagagctcatattagaaacagcaaaaagttttaaggaagtgatcaataggcctattaaa
aaggtgccttccttgagagatatcaccattgctaatctattctttgaaaattctacccgt
actcgtctttcctttgagttagcagagaagagactttcagcagatactattaattttact
tcttccggtagttcagttaaaaaaggggaaacccttttggacactgtaaataacatccta
gccatgaaggtagatatggtagtcatgcgtcatagcagcccgggagctccacatttcttg
tcggataagatcaaagctaacatagtaaatgccggagacggtactcatgagcaccctacc
caggcccttcttgactctttctccatgcaggagaggttaggagatttggccgggaaaagg
atagctattataggtgacattacccactcaagggtagctttgtctaatatcttctgcttg
caaaaattaggagcagaagtggctgtttgtggtcctacaacattgatacctaaatatctt
cataccttaggcgttaaaagattcgatacggtaggagaagccttgagatggtgtgatgtg
gctaacgtattgcgtatccaactagaacgtcagcaattgaaattcttcccttctttgaga
gaatattccttgtattatggaattacgaagaagatgctggatgaattggataaagagatc
atagtcatgcatcctgggcctataaataggggtgtggaactaagctctgatgctgcggat
tccggacactctatcatcctggatcaggtggaaaacggagtagccgtgagaatggccgta
atgtatcttttggcacaaaaaaattaa

DBGET integrated database retrieval system