KEGG   Leadbetterella byssophila: Lbys_1105Help
Entry
Lbys_1105         CDS       T01350                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lby  Leadbetterella byssophila
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lbys_1105
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_1105
   00640 Propanoate metabolism
    Lbys_1105
   00660 C5-Branched dibasic acid metabolism
    Lbys_1105
Enzymes [BR:lby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lbys_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142871..1144082)
Genome map
AA seq 403 aa AA seqDB search
MNIHEYQGKEILSKYGVRVQRGVVASTVEEAEKAYQEISELTNSKFAVVKSQIHAGGRGK
GKIRGTEQRGVQLAKSAEDVKTIASNLLGNTLVTIQTGEEGKVVNKVLVAEDVYYPGDSE
PKELYVSILLDRTKACNVIMASTEGGMDIEEVAEHTPEKIIKEWIDPRVGFQGYQARNVA
YKLGLTGNANKEMVKFLTSLYKAYDETDSSMFEINPVLKTSDDKILAVDAKVNLDDNALF
RHPDLAALRDKSEEDPMEVEASESDLNYVKLDGNVGCMVNGAGLAMATMDIIKLYGGEPA
NFLDVGGGANAVTVEAGFRLILKDPNVKAIFVNIFGGIVRCDRVANGIVEAYKKIGEIPV
PIVVRLQGTNAEEGAKIINESGLKVYSAVKLKEAAELVQKVLA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtaccagggtaaagaaattttatccaaatatggggtaagagttcag
agaggggtagtggcatcaacggtagaagaagcggaaaaggcctaccaagaaatatcggaa
ctgaccaattctaagttcgccgttgtgaagtctcaaatccatgccggtggtagaggtaaa
ggaaagatcagaggaaccgagcaaagaggggttcaattggcaaaatccgccgaggatgta
aagaccattgcttcaaatctgctgggtaatacgctggtgactattcagacgggagaagaa
ggtaaagtagtaaacaaggttttagttgctgaggatgtatactatcctggggattcagaa
cctaaagaattatacgtttctattcttcttgaccgtacgaaagcctgcaacgtcatcatg
gcctctacagaaggcggtatggacattgaagaagtggctgagcacactcctgaaaagatt
atcaaagaatggattgatcctagagtaggtttccagggttatcaagccagaaacgtagct
tataaattaggtcttaccggaaatgccaataaagaaatggtgaagttcttgacttccctt
tacaaagcttacgatgagacggattcatctatgtttgaaattaacccggttctaaaaact
tctgacgataagatcttagcggtagacgctaaagtaaacttggatgataacgctttgttc
cgtcatcctgatttagcggcattaagagataagtctgaagaggatccgatggaagtggaa
gcttctgaaagtgatcttaactatgtaaaactagacggtaacgtaggatgtatggtgaac
ggtgccggtcttgctatggctaccatggacatcatcaaattatacggtggtgagcctgca
aacttccttgacgtaggtggtggagctaatgctgtaactgttgaagccggattccgtttg
atccttaaagatccaaatgtaaaagcaatcttcgttaacatcttcggtggtattgtaaga
tgtgacagggtggctaacggtatcgttgaggcttataagaagattggagaaattcctgtt
cctatcgtggttcgtttacaaggaactaacgcagaagaaggagctaaaataattaatgaa
tcaggtttgaaagtttattcagcggtgaagttgaaagaagcagcagaactagttcaaaag
gtattagcctaa

DBGET integrated database retrieval system