KEGG   Leadbetterella byssophila: Lbys_1105Help
Entry
Lbys_1105         CDS       T01350                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lby  Leadbetterella byssophila
Pathway
lby00020  Citrate cycle (TCA cycle)
lby00640  Propanoate metabolism
lby00660  C5-Branched dibasic acid metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Module
lby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lbys_1105
   00640 Propanoate metabolism
    Lbys_1105
   00660 C5-Branched dibasic acid metabolism
    Lbys_1105
Enzymes [BR:lby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lbys_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADQ16827
UniProt: E4RSY8
Position
complement(1142871..1144082)
Genome map
AA seq 403 aa AA seqDB search
MNIHEYQGKEILSKYGVRVQRGVVASTVEEAEKAYQEISELTNSKFAVVKSQIHAGGRGK
GKIRGTEQRGVQLAKSAEDVKTIASNLLGNTLVTIQTGEEGKVVNKVLVAEDVYYPGDSE
PKELYVSILLDRTKACNVIMASTEGGMDIEEVAEHTPEKIIKEWIDPRVGFQGYQARNVA
YKLGLTGNANKEMVKFLTSLYKAYDETDSSMFEINPVLKTSDDKILAVDAKVNLDDNALF
RHPDLAALRDKSEEDPMEVEASESDLNYVKLDGNVGCMVNGAGLAMATMDIIKLYGGEPA
NFLDVGGGANAVTVEAGFRLILKDPNVKAIFVNIFGGIVRCDRVANGIVEAYKKIGEIPV
PIVVRLQGTNAEEGAKIINESGLKVYSAVKLKEAAELVQKVLA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtaccagggtaaagaaattttatccaaatatggggtaagagttcag
agaggggtagtggcatcaacggtagaagaagcggaaaaggcctaccaagaaatatcggaa
ctgaccaattctaagttcgccgttgtgaagtctcaaatccatgccggtggtagaggtaaa
ggaaagatcagaggaaccgagcaaagaggggttcaattggcaaaatccgccgaggatgta
aagaccattgcttcaaatctgctgggtaatacgctggtgactattcagacgggagaagaa
ggtaaagtagtaaacaaggttttagttgctgaggatgtatactatcctggggattcagaa
cctaaagaattatacgtttctattcttcttgaccgtacgaaagcctgcaacgtcatcatg
gcctctacagaaggcggtatggacattgaagaagtggctgagcacactcctgaaaagatt
atcaaagaatggattgatcctagagtaggtttccagggttatcaagccagaaacgtagct
tataaattaggtcttaccggaaatgccaataaagaaatggtgaagttcttgacttccctt
tacaaagcttacgatgagacggattcatctatgtttgaaattaacccggttctaaaaact
tctgacgataagatcttagcggtagacgctaaagtaaacttggatgataacgctttgttc
cgtcatcctgatttagcggcattaagagataagtctgaagaggatccgatggaagtggaa
gcttctgaaagtgatcttaactatgtaaaactagacggtaacgtaggatgtatggtgaac
ggtgccggtcttgctatggctaccatggacatcatcaaattatacggtggtgagcctgca
aacttccttgacgtaggtggtggagctaatgctgtaactgttgaagccggattccgtttg
atccttaaagatccaaatgtaaaagcaatcttcgttaacatcttcggtggtattgtaaga
tgtgacagggtggctaacggtatcgttgaggcttataagaagattggagaaattcctgtt
cctatcgtggttcgtttacaaggaactaacgcagaagaaggagctaaaataattaatgaa
tcaggtttgaaagtttattcagcggtgaagttgaaagaagcagcagaactagttcaaaag
gtattagcctaa

DBGET integrated database retrieval system