KEGG   Leadbetterella byssophila: Lbys_1116Help
Entry
Lbys_1116         CDS       T01350                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lby  Leadbetterella byssophila
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lbys_1116
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Lbys_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157427..1157906
Genome map
AA seq 159 aa AA seqDB search
MHRLYLGLGSNLGERKTLLDSAIRSIEHKIGQIQKISPFYETEPWGVENQTPYLNVVVEV
LTTLWPLAILHLVQEIEKEGGRERKERWGSRTIDIDILFFNQEIFTFSDLQVPHPRIQDR
NFVLYPLADLAPNLVHPVFNKNILELKEQCKDTSWICAY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcctatatctaggattaggttcaaatcttggtgaaagaaaaaccttactagac
tcggcaattcgaagcatagagcataaaataggtcagattcaaaaaatctctccattttat
gaaactgaaccatggggtgtagagaatcaaacgccttacttaaatgtagttgtagaagtc
ttaactaccctttggcccttagctatacttcatttggttcaagaaattgaaaaggaaggc
ggcagagaaaggaaagaaagatggggcagtagaaccatagatattgatatcctttttttt
aatcaggaaattttcaccttctcagatttacaggttccacaccctagaatacaggatagg
aattttgtactataccctttggctgaccttgccccaaatttagtccacccggttttcaat
aaaaacattttggaactaaaagaacaatgtaaagacacttcctggatatgcgcatactag

DBGET integrated database retrieval system