KEGG   Leadbetterella byssophila: Lbys_1247Help
Entry
Lbys_1247         CDS       T01350                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lby  Leadbetterella byssophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Lbys_1247
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lbys_1247
Enzymes [BR:lby01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Lbys_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290476..1291084
Genome map
AA seq 202 aa AA seqDB search
MMKTWLIVIVSGAVAALVLSNIGLIKNIFSAKNGISTMEENFTHKGSFYDFTVDDLEGNP
VDLSVYKGKKVVIINTASKCGFTPQYAEWQKFHEKYGDKIAVLGFPANNFMSQEPGSNEE
IAEFCQRNYGVTFKMFSKVDVKGKDKAPLYRWLSEKDLNGWNDKEPTWNFCKYVVDENGN
LTHFFESKITPDNEQFRKAVGV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacctggttaatcgtaattgtatccggagcggtagccgccttggtactaagt
aatattggtttgataaagaatatcttttctgcgaagaacggtataagcactatggaagaa
aattttacacacaaaggatccttttatgactttacagtagatgatcttgagggtaatcct
gtagatctgtctgtttacaaaggcaaaaaagtggttatcatcaacactgcttcgaaatgc
ggttttactccacaatatgcagagtggcagaaatttcatgaaaagtatggagataaaatt
gccgtcttgggctttcctgctaataattttatgagccaagaacccggaagtaacgaggaa
attgcagaattttgccagagaaattatggcgttactttcaagatgttctctaaagtagac
gtaaaaggaaaagataaggcacctctctatcgctggttaagtgaaaaggacttaaacgga
tggaacgataaagaacctacctggaacttttgcaaatacgtggtggacgaaaacggcaac
ttaacgcacttttttgaatcaaagataactccggataatgagcaattccggaaggctgta
ggagtttaa

DBGET integrated database retrieval system