KEGG   Leadbetterella byssophila: Lbys_1264Help
Entry
Lbys_1264         CDS       T01350                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
lby  Leadbetterella byssophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lby00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lbys_1264
DNA repair and recombination proteins [BR:lby03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lbys_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1309228..1309830)
Genome map
AA seq 200 aa AA seqDB search
MNYPSRTIEEAVSEISKLPGIGKKSALRMALHLLKSDKQVAHSLSSALVNLVENTTFCTE
CHNISDQSICQICSSHRRERSIIAVVQDTKDVLAIENTGQYQGLYHVLGGVIAPVQGIGP
NQLHIDALVERLRKNEEVKEVILALSPTMEGDTTAFYIRKKLAEFPIRISTIARGIPVGG
DLEYTDEITLGRSILSRIDF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatccatctagaaccatagaagaagcggtcagtgagatttcgaaactgcccggt
atcggtaagaaatcagccttgaggatggccttgcatctgcttaaatcagataagcaggtg
gcgcatagcctttcttcggctttggtgaatttggtagaaaatactaccttttgtacggaa
tgtcataatatttccgaccaaagcatatgtcaaatttgtagttctcacaggcgagaaaga
agcattattgctgtagttcaggataccaaagatgtattggcgattgaaaataccggtcag
tatcaaggtctttaccatgtgttaggcggagtcatagctccggtgcaaggtataggaccg
aatcaattgcatattgatgcattggtagagcgtttgcggaagaatgaagaggtgaaagaa
gtgatattagccctaagtcctacaatggagggggatactacagcgttctatataagaaaa
aagttggccgaattccccatcaggatctcaactattgcaagaggaattccagtgggaggg
gatttagagtatactgatgagattacattgggtcggagtattttaagtagaattgacttt
taa

DBGET integrated database retrieval system