KEGG   Leadbetterella byssophila: Lbys_1333Help
Entry
Lbys_1333         CDS       T01350                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lby  Leadbetterella byssophila
Pathway
lby00010  Glycolysis / Gluconeogenesis
lby00020  Citrate cycle (TCA cycle)
lby00620  Pyruvate metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
Module
lby_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_1333
   00020 Citrate cycle (TCA cycle)
    Lbys_1333
   00620 Pyruvate metabolism
    Lbys_1333
Enzymes [BR:lby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lbys_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADQ17052
UniProt: E4RVI8
Position
complement(1379692..1381299)
Genome map
AA seq 535 aa AA seqDB search
MAEVIRMPKMSDTMTEGVIAAWNVKVGDVVKSGDILAEVETDKATMDMESYYDGTVLYIG
VEKGQAVPIDAVIAVIGKPGEDFQSLLGGSAATAEEKPEAPKAEESAPAVDTSNIKAAVI
KMPLLSDTMTEGVIHKWLKNVGDKVKSGDLLAEIETDKATMEIEAYEEGTLLYVGVKEGE
AAAVNAVIAIIGEEGADYETLLKAESAPAKAQAAAPAATPASAATPAPAPAPAATPAPAA
TPASNNNGRILASPLAKSLAKEKGIDLALVKGSGEGGRIIKADIDNYVPAAAPAKGATAL
TPAIAGQESFEEIPLTQMRKAIARSLADSQANAVDFQLTMEICMDNAIKARGVMNEASPV
KISFNDMVLKACGVALRKHPEINSSWRGDHIRKNHHVHIGMAVAIPEGLVVPVIRFADAL
PLSQLAATTKELGGKAKSGKLQPADWEGNTFTVSNLGMFGIDSFTSIINNPKNESCILSV
GGIKETVAVKDGQFYATNIMKVTLTCDHRVVDGATGAAFLVTLKQLLEEPYKLLV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattagaatgcccaaaatgagcgataccatgacggaaggagtgatcgcc
gcatggaacgtgaaagttggggatgtagtgaaatcaggtgatattctggctgaagttgag
acggataaagccactatggatatggaatcttactacgacggtaccgtattgtatatcgga
gtggagaaaggtcaagccgttcctatagatgcagttatagccgtgattggtaagccggga
gaagattttcagtctcttttaggtggaagtgctgctacggcagaagaaaaacctgaagcg
cctaaagcggaagaatccgcacctgctgtagatacatccaatattaaagccgccgtaatt
aagatgcctcttttgagtgataccatgacagaaggtgtgattcacaagtggttgaagaat
gtaggtgacaaagtgaaatccggtgaccttctggctgaaattgaaacagacaaagctact
atggagatagaagcttacgaagagggtacactattatacgtaggagttaaagaaggtgaa
gcagcagctgtaaatgcggtaatcgctattatcggagaagaaggtgctgattatgaaacc
ttattgaaagctgagtctgctcctgcaaaagctcaggccgctgctcctgcagcaacacca
gcttctgcagcaacaccggctccggcaccagcgcctgcagcaacgccagctcctgcagca
acacctgcgagcaacaacaacggtagaattttagcttctccactagctaagagcctggcc
aaagaaaaaggtattgatctagctttagtgaagggttccggagaaggcggaagaatcatt
aaagctgacatagataattatgttccagcggctgctcctgctaaaggtgcaactgccttg
acgccggctatcgctggtcaggaaagctttgaagagattccattgactcaaatgcgtaag
gctatcgcaagaagcttggcagattctcaagcgaatgccgtagacttccagttgaccatg
gaaatctgtatggacaatgctatcaaggctcgtggcgtgatgaatgaagcatctccagtg
aagatttcattcaatgacatggtattgaaagcttgtggcgtagctttaagaaagcatcct
gaaatcaactcttcttggagaggagatcatatccgcaaaaatcatcatgtacatattggt
atggcggttgctattcctgagggcttagtagtacctgtgattcgttttgcagatgctctt
cctctatctcaattagctgctaccacaaaagaacttggtggtaaagcgaagagtggaaaa
ttacaaccggctgactgggaaggaaacacctttacagtaagtaacttaggaatgtttgga
attgattcatttacttccatcattaataaccctaagaacgaatcttgtattctttcagta
ggtggaattaaagaaacagtggctgtaaaagatggtcaattctacgctacaaacattatg
aaagtaaccttgacttgtgaccacagagtggttgacggagctactggtgcagctttctta
gtgaccttgaagcaacttctagaagagccttacaagttattagtataa

DBGET integrated database retrieval system