KEGG   Leadbetterella byssophila: Lbys_1517Help
Entry
Lbys_1517         CDS       T01350                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lby  Leadbetterella byssophila
Pathway
lby00010  Glycolysis / Gluconeogenesis
lby00030  Pentose phosphate pathway
lby00051  Fructose and mannose metabolism
lby00052  Galactose metabolism
lby00680  Methane metabolism
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01120  Microbial metabolism in diverse environments
lby01130  Biosynthesis of antibiotics
lby01200  Carbon metabolism
lby01230  Biosynthesis of amino acids
lby03018  RNA degradation
Module
lby_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbys_1517
   00030 Pentose phosphate pathway
    Lbys_1517
   00051 Fructose and mannose metabolism
    Lbys_1517
   00052 Galactose metabolism
    Lbys_1517
  Energy metabolism
   00680 Methane metabolism
    Lbys_1517
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Lbys_1517
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lbys_1517
Protein phosphatases and associated proteins [BR:lby01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lbys_1517
Messenger RNA biogenesis [BR:lby03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Lbys_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-ProteinID: ADQ17229
UniProt: E4RXJ4
Position
complement(1568420..1569397)
Genome map
AA seq 325 aa AA seqDB search
MKKIAVYTSGGDAPGMNACIRAVVRGAIYHGLQVYGIRRGYNGMISGDIFEMTSTSVSNI
VQRGGTILKSARSKEFMTPEGRKKAYENLMKLGIDGLVAIGGNGTFTGAEVFYNEYQIPT
VGCPGTIDNDLYGTDYTIGFDSAVNTSLEAIDKIRDTADSHDRVFFIEVMGRDSGYIAVQ
SGIGGGAEIVMVPETHTPLKKVVSSLKDGLRRSKSSSIVVVVAEGDEEGHATEIAEKIKS
QVGDKLDIRVTTLGHVQRGGAPTAYDRILASRMGLAAVEGLMSGQKNVMAGVVNNEIVYT
PFIDTIKKTKPIHDDLLRMVHILSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcggtttacacttctggtggagacgctccgggtatgaatgcctgtata
cgtgccgtagttagaggagccatttatcatggccttcaagtttacggtatccgcaggggg
tataacgggatgatttctggagatatatttgagatgacttcaacttctgtaagtaatata
gttcaaaggggaggtaccattttgaagtctgcacgtagtaaggagtttatgacgccggag
ggaaggaagaaggcttatgagaacttgatgaaactaggcatagatggattagtagctata
ggaggaaacggtacttttacaggtgctgaggtattctataatgaataccagatccctacg
gtgggctgtccgggtactattgataatgatttatatggaacggactatactataggattt
gattcggcagtaaacacttcacttgaagctatagataaaattagagacactgctgattca
catgatcgtgtattctttatagaagtgatgggtcgtgattcaggctatattgcggtacaa
tcaggtataggtggaggtgctgaaatcgtgatggtacctgaaactcatactccattgaaa
aaggtagtttcttctttgaaagatggattgagacgttcaaaatcctcctctatagtagta
gtggtagctgagggtgatgaagaaggacatgctacagaaattgctgaaaagataaaatcg
caggtaggtgataaattagatatccgtgttactacgcttggccacgtgcagaggggagga
gctcctaccgcgtatgacaggatattggcttccagaatgggacttgcagcagtggaagga
ctaatgagcggtcaaaagaacgttatggcgggggttgtaaacaatgaaatcgtttatact
ccgtttattgataccatcaagaagacaaaacctatacatgatgatcttctacgtatggtt
catatattaagtatttaa

DBGET integrated database retrieval system