KEGG   Leadbetterella byssophila: Lbys_1625Help
Entry
Lbys_1625         CDS       T01350                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
lby  Leadbetterella byssophila
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lby00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lby00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1694871..1695821
Genome map
AA seq 316 aa AA seqDB search
METKMAIKLLLLVLLAIPTLGQDADFVVAKDGSGDFLTVQEAINAVPDFRKKRTIILIKP
GVYKEKIVLAESKSQVTLLGADPTVTILTYDDYATKPNRFGEEMGTTGSSSFYAFGEGFA
AKNITFQNTAGPVGQAVAIWVKGDKSYFENCRFLGFQDTLYTYGKESRQYYKNCYIEGTV
DFIFGSSIALFENCEIFCKGKGYITAASTPQWRPYGYVFKNCIIKGEEKESHYLGRPWRP
YARVVFLDSELSEVIKPEGWDNWRNPENEKTAFFAELGNRGSGAKTDKRVAWAQKKLEKG
DFEWNKIFGDWTLENQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaaaatggctataaaactacttcttttggtccttttggccatccccacctta
ggtcaggatgctgattttgtagtagcaaaagatggatccggagatttccttacggtacag
gaagctatcaatgccgttcctgatttcaggaagaagagaactataatcttgataaagccg
ggagtttataaggaaaaaatagtgcttgcagaatctaagtctcaggtcactctgctaggc
gcggatcctacagtcactattttaacatatgacgactatgctaccaagccgaaccgtttt
ggagaagagatgggcaccacaggatcatcctccttttatgcctttggggaagggttcgca
gcaaaaaacattacatttcaaaataccgcgggacctgtaggccaagctgtggccatatgg
gttaaaggagataagtcgtattttgaaaattgccgattccttggatttcaagacaccttg
tatacctatggcaaggaaagtagacaatactacaaaaactgctacatagaaggaacggta
gatttcatctttggctcttctatagccttatttgagaactgtgagatcttttgcaaagga
aaaggatacataactgcagcttctaccccacagtggagaccctacggatatgtgtttaaa
aactgtataatcaaaggggaagaaaaagaaagccattatctaggcagaccttggcgcccc
tatgccagagtggtttttctggattccgaactatctgaggttataaagccggaaggctgg
gacaactggagaaatcctgaaaacgagaagacagcattttttgctgaacttggaaacaga
ggctctggagctaaaacagataaaagggtggcttgggcccagaaaaaattggaaaaagga
gactttgaatggaacaaaatatttggggattggaccctagaaaatcaataa

DBGET integrated database retrieval system