KEGG   Leadbetterella byssophila: Lbys_1680Help
Entry
Lbys_1680         CDS       T01350                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lby  Leadbetterella byssophila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lbys_1680
Enzymes [BR:lby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lbys_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761564..1762166
Genome map
AA seq 200 aa AA seqDB search
MKGKAIIFCAPSGSGKTTLVKHLLSQYSNLGFSISACTRDKRGRNEIHGKDYYFLSIEEF
QENIRANAFVEWEEVYPGGYYGTLKSEVERLWNEGKNVIFDVDVKGGLKLKEYFGEDALA
IFVKVPSIEELEARLRSRGTETEESLSKRLYKVKFEMSFQDKFDVVLLNDNLEESQEKAE
NLYTTFLEGNLNLDEKPLRV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaagccatcatattctgcgctccatccgggtcaggaaaaactacccttgtt
aaacatttattgtcgcaatattctaatttaggtttctctatttctgcctgtacacgtgac
aaaagagggagaaatgagattcacggaaaagactactatttcctttccattgaagaattc
caagagaatatccgcgccaatgcctttgtagaatgggaagaagtttatccaggtggatat
tatggcaccttaaaatcagaagtagagcgcctttggaatgaaggaaaaaacgtcatcttt
gacgtagatgtgaaaggaggccttaaattgaaggaatactttggagaggatgccttggcc
atctttgtaaaggttccatccatagaagaacttgaagctcgcctcagaagcagaggcacg
gaaacggaagaaagcctttccaaaagattatataaagtcaaattcgaaatgtcattccag
gataaatttgacgtggttcttttaaacgataatttggaagaatctcaagagaaagcagaa
aacctctacaccactttcctggagggaaatctaaatctagatgaaaaacctttgagggta
tga

DBGET integrated database retrieval system