KEGG   Leadbetterella byssophila: Lbys_1680Help
Entry
Lbys_1680         CDS       T01350                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lby  Leadbetterella byssophila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lby00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761564..1762166
Genome map
AA seq 200 aa AA seqDB search
MKGKAIIFCAPSGSGKTTLVKHLLSQYSNLGFSISACTRDKRGRNEIHGKDYYFLSIEEF
QENIRANAFVEWEEVYPGGYYGTLKSEVERLWNEGKNVIFDVDVKGGLKLKEYFGEDALA
IFVKVPSIEELEARLRSRGTETEESLSKRLYKVKFEMSFQDKFDVVLLNDNLEESQEKAE
NLYTTFLEGNLNLDEKPLRV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaagccatcatattctgcgctccatccgggtcaggaaaaactacccttgtt
aaacatttattgtcgcaatattctaatttaggtttctctatttctgcctgtacacgtgac
aaaagagggagaaatgagattcacggaaaagactactatttcctttccattgaagaattc
caagagaatatccgcgccaatgcctttgtagaatgggaagaagtttatccaggtggatat
tatggcaccttaaaatcagaagtagagcgcctttggaatgaaggaaaaaacgtcatcttt
gacgtagatgtgaaaggaggccttaaattgaaggaatactttggagaggatgccttggcc
atctttgtaaaggttccatccatagaagaacttgaagctcgcctcagaagcagaggcacg
gaaacggaagaaagcctttccaaaagattatataaagtcaaattcgaaatgtcattccag
gataaatttgacgtggttcttttaaacgataatttggaagaatctcaagagaaagcagaa
aacctctacaccactttcctggagggaaatctaaatctagatgaaaaacctttgagggta
tga

DBGET integrated database retrieval system