KEGG   Leadbetterella byssophila: Lbys_1832Help
Entry
Lbys_1832         CDS       T01350                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
lby  Leadbetterella byssophila
Brite
Enzymes [BR:lby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Lbys_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916448..1917545)
Genome map
AA seq 365 aa AA seqDB search
MKKLIWMFWGILPGMAQEVTLKEVYKGAFKMGTAVNMEMMQDPLVKQQFNSVTPENVMKA
EEVCPAPGVYDFSKADEFVRWAQGMFIVGHTLIWHNQTPSWFFEQADGSKKSPEDVKEQL
REHIQKVAGRYAGKVHAWDVVNEVIDDDGSYRSTLWVNGVGSGDELVKLAFKYAAEYAPD
TELYYNDFNAWRPEKVKGIVRMIKMLQAEGIRIDGVGIQGHWGLNYPKSEYIEAAIEAYA
ACGVKVMITELDVDVLPLTREGQIIGQGMMHKQFQNEEFKVYLDPYRDGLPTEVEEQLAR
RYKELFEIFYRKRDKIDRVTVWGMKDGMSWKNDYPIPGRTNYPLLWNRDGSPKMAWYRVL
EVVKE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaactaatatggatgttttggggcatacttccgggaatggcacaggaagtaact
cttaaagaagtgtataaaggtgcctttaagatgggaactgcggtgaatatggagatgatg
caggatcccttggtgaagcagcaattcaatagcgtgacgccggagaatgtcatgaaggca
gaagaggtatgtccggcgcccggtgtatatgattttagtaaggcggatgagtttgtacgt
tgggctcagggcatgtttatcgtggggcataccctgatttggcataatcaaactccttct
tggttctttgagcaggcagacggtagtaagaagagtccggaggatgtcaaggagcaattg
agagagcacattcaaaaagtggcagggagatatgcgggtaaggtacatgcatgggatgtg
gtgaatgaggtcatagatgatgatgggtcatatagatccacattgtgggtgaatggggtg
ggaagcggagatgagttggtgaagttggcctttaaatatgctgccgagtatgccccggac
acggagttgtattataatgattttaatgcttggcgaccggagaaggtgaaaggtatagta
aggatgatcaagatgctacaagcggaaggtatccgcatagacggagtagggattcagggg
cattggggtttgaattatccaaaaagcgagtatatagaggcggcaatagaagcatatgcg
gcttgtggggtaaaggtaatgatcacggaactggatgtggacgtacttcccttaaccaga
gaagggcagatcatagggcagggtatgatgcataagcagtttcagaacgaggagttcaag
gtgtatttggatccctatcgggatggtttgcctacggaggtagaggagcaattggctagg
aggtataaggagttgtttgagatattttacaggaagagggataagatagatagagtaacg
gtttggggaatgaaagatggcatgtcatggaagaacgactatcctatacctggcagaaca
aactatcctttgttgtggaacagggacggtagtccgaagatggcatggtatagggtattg
gaagtggtgaaagagtag

DBGET integrated database retrieval system