KEGG   Leadbetterella byssophila: Lbys_1908Help
Entry
Lbys_1908         CDS       T01350                                 

Definition
l-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lby  Leadbetterella byssophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lbys_1908
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbys_1908
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lbys_1908
Enzymes [BR:lby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lbys_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2008655..2009959)
Genome map
AA seq 434 aa AA seqDB search
MRLQSTRHQSPEVGFKEAIFRGLPPDNGLYLPVEIPTLSSSFWQYCDQLNFQEIATAMAC
GILQGSIPEKELRALIFKAMDFSAPAVKLHKDLYCLELFHGPSMAFKDFGARFMATTMSY
FLEQSGEKLNILVATSGDTGGAVAQGFFGVPGISVTILYPKGKVSQVQELQLTTLGGNVK
AIEVNGTFDDCQALVKQAFLDEELRSKYRLASANSINIARLIPQSFYYAYAYAQLKHLWK
DLVISVPSGNFGNLTAGVMAMKMGMPVSYFVAATNVNKVVPNYLESGEFQPISPSIPTLS
NAMDVGNPSNFPRLLALFNGDVEKMRAKIKGFSFTDEETKLGVKELYESYHYLACPHTSV
AYLGLKKAMEMDGGEHAGVFLSTAHFGKFLPEMESILGFSPELPEALQISGKKEATEMDN
TYAKFRAYLTQHLI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcaaagtacccgtcatcaaagtcctgaagtaggatttaaagaggccattttc
cggggtttaccgccggacaatggcctttatttgcctgtagagattcctaccttgtcttct
tccttttggcagtactgtgaccaattgaactttcaggaaatcgccacggctatggcctgt
ggaatcctgcaagggagtattcccgagaaggaattaagggctttaatctttaaagccatg
gactttagtgctcctgctgtgaagctccataaagacttgtactgccttgaattgtttcat
ggtccttctatggccttcaaggacttcggtgcgcgttttatggccactaccatgtcctac
ttcttagaacagagtggtgagaaactgaatattttagttgccacctcaggtgataccggt
ggggcagtggcacaaggtttcttcggggtgccaggtatttccgttactattttatatcca
aagggaaaggtttctcaagtgcaggagctgcagctcacaaccctgggaggtaacgtcaag
gccattgaagtaaacggcacttttgatgattgtcaggctttggtaaaacaagccttcctg
gacgaggagttaagatctaagtacagattggcttcggctaattccatcaatattgcccgc
cttattccgcaatctttctattatgcttatgcctatgcgcaattgaagcatctgtggaaa
gatttagtgatctctgtgccttcgggcaactttgggaacctgacggcaggtgttatggct
atgaaaatgggtatgccggtttcttattttgtagctgccacaaatgtgaataaagtggtg
cctaattatctagaatctggtgaatttcaacccatatccccttctatacctaccttatct
aatgctatggatgtggggaatccaagtaattttccgcgacttttagcgctctttaacgga
gacgtagaaaaaatgcgagctaagatcaaaggattttcctttacggacgaagagacgaag
ctaggagttaaggaattgtatgaatcctatcattatttggcatgtccgcatacttctgta
gcctatttgggcttgaaaaaagccatggaaatggatggaggtgaacatgcaggtgtattt
ctttctactgctcacttcggtaaattcctgcctgaaatggagagtatcctcggatttagt
cctgagcttcctgaggcattgcaaatttcaggaaagaaagaagctacagagatggataat
acttacgccaagtttagagcttatctcacccagcatttaatctga

DBGET integrated database retrieval system