KEGG   Leadbetterella byssophila: Lbys_1967Help
Entry
Lbys_1967         CDS       T01350                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lby  Leadbetterella byssophila
Pathway
lby00260  Glycine, serine and threonine metabolism
lby00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lby01100  Metabolic pathways
lby01110  Biosynthesis of secondary metabolites
lby01130  Biosynthesis of antibiotics
lby01230  Biosynthesis of amino acids
Module
lby_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbys_1967
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lbys_1967
Enzymes [BR:lby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lbys_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Diphthami_syn_2
Motif
Other DBs
NCBI-ProteinID: ADQ17667
UniProt: E4RSD1
Position
complement(2088312..2089091)
Genome map
AA seq 259 aa AA seqDB search
MNRIEQLFADKKGEILSIYFTAGFPGPEDTRVILKALQSSGVDLVEIGMPYSDPVADGET
IQASNQRALDQGMSVEKLFGQLATMRSEGITIPVILMGYLNPVYQYGIEKFCAKCKEIGV
DGLILPDLPLDEYKGEYEEIFRRYGLLNIFLITPQTSDERIKEIDANSSGFIYMVSSASV
TGATSGVNDQMEAYFERVRSLGLKNPQLVGFGIKDKDSFQRASKHASGAIIGSQFVRVLE
ASASDLEAGIQEFIKGVRD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagagcagctttttgcagataagaaaggagagatactgagtatatatttt
acggccggatttccgggtcctgaagatacgcgagtcattttgaaagctttacaaagctcc
ggtgtggatttggtagaaataggtatgccttactctgatcctgtggcagatggggagacc
attcaggcttcaaatcaacgtgctttggatcagggaatgagtgtagagaagctttttggc
caattggccactatgcgctcagaaggtattactattccggtgatcttgatgggttatttg
aatccagtttatcagtatggcattgagaagttttgtgccaaatgtaaagagatcggagta
gacgggctgatacttcctgatctgccattggatgaatacaaaggtgagtacgaagagatc
tttagaaggtatggtctattgaacatattcttgattactcctcaaacatctgatgagcgg
attaaggagatagatgcgaattcttccggattcatatatatggtttcttctgccagtgtt
accggtgctacatcaggcgtgaatgatcagatggaagcgtattttgagcgagtaaggtct
ttgggtttgaagaatcctcaattggtaggatttggtatcaaagacaaggatagtttccaa
agggcttcaaagcatgcatccggagccattataggaagccagtttgttagagtattggaa
gcgtccgcttcggatctggaggcaggaatacaggaatttataaaaggagtaagagattaa

DBGET integrated database retrieval system