KEGG   Leadbetterella byssophila: Lbys_1967Help
Entry
Lbys_1967         CDS       T01350                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lby  Leadbetterella byssophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lbys_1967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lbys_1967
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lbys_1967
Enzymes [BR:lby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lbys_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2088312..2089091)
Genome map
AA seq 259 aa AA seqDB search
MNRIEQLFADKKGEILSIYFTAGFPGPEDTRVILKALQSSGVDLVEIGMPYSDPVADGET
IQASNQRALDQGMSVEKLFGQLATMRSEGITIPVILMGYLNPVYQYGIEKFCAKCKEIGV
DGLILPDLPLDEYKGEYEEIFRRYGLLNIFLITPQTSDERIKEIDANSSGFIYMVSSASV
TGATSGVNDQMEAYFERVRSLGLKNPQLVGFGIKDKDSFQRASKHASGAIIGSQFVRVLE
ASASDLEAGIQEFIKGVRD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagagcagctttttgcagataagaaaggagagatactgagtatatatttt
acggccggatttccgggtcctgaagatacgcgagtcattttgaaagctttacaaagctcc
ggtgtggatttggtagaaataggtatgccttactctgatcctgtggcagatggggagacc
attcaggcttcaaatcaacgtgctttggatcagggaatgagtgtagagaagctttttggc
caattggccactatgcgctcagaaggtattactattccggtgatcttgatgggttatttg
aatccagtttatcagtatggcattgagaagttttgtgccaaatgtaaagagatcggagta
gacgggctgatacttcctgatctgccattggatgaatacaaaggtgagtacgaagagatc
tttagaaggtatggtctattgaacatattcttgattactcctcaaacatctgatgagcgg
attaaggagatagatgcgaattcttccggattcatatatatggtttcttctgccagtgtt
accggtgctacatcaggcgtgaatgatcagatggaagcgtattttgagcgagtaaggtct
ttgggtttgaagaatcctcaattggtaggatttggtatcaaagacaaggatagtttccaa
agggcttcaaagcatgcatccggagccattataggaagccagtttgttagagtattggaa
gcgtccgcttcggatctggaggcaggaatacaggaatttataaaaggagtaagagattaa

DBGET integrated database retrieval system