KEGG   Leadbetterella byssophila: Lbys_2007Help
Entry
Lbys_2007         CDS       T01350                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lby  Leadbetterella byssophila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lbys_2007
   00670 One carbon pool by folate
    Lbys_2007
Enzymes [BR:lby01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Lbys_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2137847..2138341
Genome map
AA seq 164 aa AA seqDB search
MEIALLVAVAENGVIGKDNQLLWKLRDDLQLFKKRTLGHPIIMGRKTYESIGKPLPGRTN
IVISRNAGLKLEGCTVTSSLEEALEVAQNLHPEQEIFVIGGGKIYELATPIATKLYLTKV
NVVLEGDTYFDLKPFENWQIVEQISLPKSEHNEYDAEVITLTRS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggagatagcattactcgtagcggtagcagaaaatggtgtaattgggaaagataaccaa
cttctttggaagctacgtgatgatcttcaactcttcaagaaaagaacgctgggacacccc
attatcatgggaaggaaaacctatgaatccataggaaaaccacttcctggtaggacaaat
atcgtgatctctagaaatgcaggattaaaattagaaggctgtaccgtaacctcatctctg
gaagaggctttagaagttgcccaaaaccttcatccggaacaagaaatttttgtaattgga
ggtggaaaaatttatgaacttgccactccgatagccaccaaactctacctcactaaggtt
aatgtagtattggaaggagatacctattttgatctaaaaccttttgaaaactggcagata
gtagaacaaatttccctccctaaatcagagcataacgaatatgacgctgaagtcataact
cttactagatcgtaa

DBGET integrated database retrieval system